BLASTX nr result
ID: Rehmannia32_contig00028752
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00028752 (380 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009336428.1| hypothetical chloroplast RF21 (chloroplast) ... 68 2e-12 gb|AJW67282.1| ycf2 protein, partial (chloroplast) [Tordylium ma... 68 2e-12 gb|AJW67279.1| ycf2 protein, partial (chloroplast) [Heracleum le... 68 2e-12 gb|AJW67276.1| ycf2 protein, partial (chloroplast) [Leiotulus da... 68 2e-12 gb|AJW67273.1| ycf2 protein, partial (chloroplast) [Pastinaca cl... 68 2e-12 ref|YP_009108266.1| hypothetical hloroplast RF21 [Cistanche phel... 72 3e-12 gb|KZM80625.1| hypothetical protein DCAR_031999 [Daucus carota s... 68 4e-12 gb|AJW67287.1| ycf2 protein, partial (chloroplast) [Ducrosia ane... 67 5e-12 gb|EPS74500.1| hypothetical protein M569_00217, partial [Genlise... 71 9e-12 gb|AQS79829.1| hypothetical chloroplast RF21 (chloroplast) [Utri... 71 9e-12 ref|YP_008082624.1| hypothetical chloroplast RF21 (chloroplast) ... 71 9e-12 ref|YP_009108538.1| Ycf2 (chloroplast) [Utricularia macrorhiza] ... 71 9e-12 ref|YP_009466368.1| hypothetical chloroplast RF21 (chloroplast) ... 71 9e-12 ref|YP_009466594.1| hypothetical chloroplast RF21 (chloroplast) ... 71 9e-12 ref|YP_009466518.1| hypothetical chloroplast RF21 (chloroplast) ... 71 9e-12 ref|YP_009466442.1| hypothetical chloroplast RF21 (chloroplast) ... 71 9e-12 ref|YP_009466292.1| hypothetical chloroplast RF21 (chloroplast) ... 71 9e-12 ref|YP_009002306.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] >g... 71 9e-12 ref|YP_009002298.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] >g... 71 9e-12 ref|YP_009466681.1| hypothetical chloroplast RF21 (chloroplast) ... 71 9e-12 >ref|YP_009336428.1| hypothetical chloroplast RF21 (chloroplast) [Nicotiana otophora] ref|YP_009336456.1| hypothetical chloroplast RF21 (chloroplast) [Nicotiana otophora] gb|ALT14523.1| hypothetical chloroplast RF21 (chloroplast) [Nicotiana otophora] gb|ALT14552.1| hypothetical chloroplast RF21 (chloroplast) [Nicotiana otophora] Length = 84 Score = 67.8 bits (164), Expect = 2e-12 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RW RTNSSLS GSF SNTLSESYQYLS FLSN TLLDQ Sbjct: 24 QRWLRTNSSLSNGSFRSNTLSESYQYLSNLFLSNGTLLDQ 63 >gb|AJW67282.1| ycf2 protein, partial (chloroplast) [Tordylium maximum] gb|AJW67283.1| ycf2 protein, partial (chloroplast) [Zosima absinthifolia] gb|AJW67284.1| ycf2 protein, partial (chloroplast) [Zosima orientalis] gb|AJW67285.1| ycf2 protein, partial (chloroplast) [Semenovia dissectifolia] Length = 88 Score = 67.8 bits (164), Expect = 2e-12 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RWFRT SSLS GSF SNTLSESYQYLS FLSN TLLDQ Sbjct: 12 QRWFRTTSSLSNGSFRSNTLSESYQYLSNLFLSNGTLLDQ 51 >gb|AJW67279.1| ycf2 protein, partial (chloroplast) [Heracleum lehmannianum] Length = 90 Score = 67.8 bits (164), Expect = 2e-12 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RWFRT SSLS GSF SNTLSESYQYLS FLSN TLLDQ Sbjct: 14 QRWFRTTSSLSNGSFRSNTLSESYQYLSNLFLSNGTLLDQ 53 >gb|AJW67276.1| ycf2 protein, partial (chloroplast) [Leiotulus dasyanthus] gb|AJW67277.1| ycf2 protein, partial (chloroplast) [Leiotulus secacul] gb|AJW67278.1| ycf2 protein, partial (chloroplast) [Leiotulus porphyrodiscus] Length = 90 Score = 67.8 bits (164), Expect = 2e-12 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RWFRT SSLS GSF SNTLSESYQYLS FLSN TLLDQ Sbjct: 14 QRWFRTTSSLSNGSFRSNTLSESYQYLSNLFLSNGTLLDQ 53 >gb|AJW67273.1| ycf2 protein, partial (chloroplast) [Pastinaca clausii] gb|AJW67275.1| ycf2 protein, partial (chloroplast) [Malabaila suaveolens] gb|AJW67280.1| ycf2 protein, partial (chloroplast) [Heracleum leskovii] Length = 90 Score = 67.8 bits (164), Expect = 2e-12 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RWFRT SSLS GSF SNTLSESYQYLS FLSN TLLDQ Sbjct: 14 QRWFRTTSSLSNGSFRSNTLSESYQYLSNLFLSNGTLLDQ 53 >ref|YP_009108266.1| hypothetical hloroplast RF21 [Cistanche phelypaea] ref|YP_009108271.1| hypothetical chloroplast RF21 [Cistanche phelypaea] emb|CDH98456.1| hypothetical hloroplast RF21 (plastid) [Cistanche phelypaea] emb|CDH98466.1| hypothetical chloroplast RF21 (plastid) [Cistanche phelypaea] Length = 2319 Score = 72.4 bits (176), Expect = 3e-12 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RW RTNSSLS GSFHSNTLSESYQYLS FLSN TLLDQ Sbjct: 2259 QRWLRTNSSLSNGSFHSNTLSESYQYLSTLFLSNETLLDQ 2298 >gb|KZM80625.1| hypothetical protein DCAR_031999 [Daucus carota subsp. sativus] Length = 113 Score = 67.8 bits (164), Expect = 4e-12 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RWFRT SSLS GSF SNTLSESYQYLS FLSN TLLDQ Sbjct: 37 QRWFRTTSSLSNGSFRSNTLSESYQYLSNLFLSNGTLLDQ 76 >gb|AJW67287.1| ycf2 protein, partial (chloroplast) [Ducrosia anethifolia] Length = 88 Score = 67.0 bits (162), Expect = 5e-12 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RWFRT SSLS GSF SNTLSESYQYLS FLSN TLLDQ Sbjct: 12 QRWFRTASSLSNGSFRSNTLSESYQYLSNLFLSNGTLLDQ 51 >gb|EPS74500.1| hypothetical protein M569_00217, partial [Genlisea aurea] Length = 2262 Score = 71.2 bits (173), Expect = 9e-12 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RW RTNSSLS GSF SNTLSESYQYLS FLSNRTLLDQ Sbjct: 2202 QRWLRTNSSLSNGSFRSNTLSESYQYLSTLFLSNRTLLDQ 2241 >gb|AQS79829.1| hypothetical chloroplast RF21 (chloroplast) [Utricularia foliosa] gb|AQS79849.1| hypothetical chloroplast RF21 (chloroplast) [Utricularia foliosa] Length = 2266 Score = 71.2 bits (173), Expect = 9e-12 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RW RTNSSLS GSF SNTLSESYQYLS FLSNRTLLDQ Sbjct: 2192 QRWLRTNSSLSNGSFRSNTLSESYQYLSTIFLSNRTLLDQ 2231 >ref|YP_008082624.1| hypothetical chloroplast RF21 (chloroplast) [Utricularia gibba] ref|YP_008082645.1| hypothetical chloroplast RF21 (chloroplast) [Utricularia gibba] gb|AGL61118.1| hypothetical chloroplast RF21 (chloroplast) [Utricularia gibba] gb|AGL61140.1| hypothetical chloroplast RF21 (chloroplast) [Utricularia gibba] Length = 2271 Score = 71.2 bits (173), Expect = 9e-12 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RW RTNSSLS GSF SNTLSESYQYLS FLSNRTLLDQ Sbjct: 2197 QRWLRTNSSLSNGSFRSNTLSESYQYLSTLFLSNRTLLDQ 2236 >ref|YP_009108538.1| Ycf2 (chloroplast) [Utricularia macrorhiza] ref|YP_009108552.1| Ycf2 (chloroplast) [Utricularia macrorhiza] emb|CDL78776.1| Ycf2 (chloroplast) [Utricularia macrorhiza] emb|CDL78790.1| Ycf2 (chloroplast) [Utricularia macrorhiza] Length = 2272 Score = 71.2 bits (173), Expect = 9e-12 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RW RTNSSLS GSF SNTLSESYQYLS FLSNRTLLDQ Sbjct: 2198 QRWLRTNSSLSNGSFRSNTLSESYQYLSTIFLSNRTLLDQ 2237 >ref|YP_009466368.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea filiformis] ref|YP_009466378.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea filiformis] gb|AUN28422.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea filiformis] gb|AUN28431.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea filiformis] Length = 2274 Score = 71.2 bits (173), Expect = 9e-12 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RW RTNSSLS GSF SNTLSESYQYLS FLSNRTLLDQ Sbjct: 2200 QRWLRTNSSLSNGSFRSNTLSESYQYLSTLFLSNRTLLDQ 2239 >ref|YP_009466594.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea tuberosa] ref|YP_009466605.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea tuberosa] gb|AUN28648.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea tuberosa] gb|AUN28658.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea tuberosa] Length = 2276 Score = 71.2 bits (173), Expect = 9e-12 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RW RTNSSLS GSF SNTLSESYQYLS FLSNRTLLDQ Sbjct: 2202 QRWLRTNSSLSNGSFRSNTLSESYQYLSTLFLSNRTLLDQ 2241 >ref|YP_009466518.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea repens] ref|YP_009466529.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea repens] gb|AUN28574.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea repens] gb|AUN28585.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea repens] Length = 2276 Score = 71.2 bits (173), Expect = 9e-12 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RW RTNSSLS GSF SNTLSESYQYLS FLSNRTLLDQ Sbjct: 2202 QRWLRTNSSLSNGSFRSNTLSESYQYLSTLFLSNRTLLDQ 2241 >ref|YP_009466442.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea pygmaea] ref|YP_009466453.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea pygmaea] gb|AUN28496.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea pygmaea] gb|AUN28507.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea pygmaea] Length = 2276 Score = 71.2 bits (173), Expect = 9e-12 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RW RTNSSLS GSF SNTLSESYQYLS FLSNRTLLDQ Sbjct: 2202 QRWLRTNSSLSNGSFRSNTLSESYQYLSTLFLSNRTLLDQ 2241 >ref|YP_009466292.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea aurea] ref|YP_009466303.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea aurea] gb|AUN28346.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea aurea] gb|AUN28357.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea aurea] Length = 2276 Score = 71.2 bits (173), Expect = 9e-12 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RW RTNSSLS GSF SNTLSESYQYLS FLSNRTLLDQ Sbjct: 2202 QRWLRTNSSLSNGSFRSNTLSESYQYLSTLFLSNRTLLDQ 2241 >ref|YP_009002306.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] emb|CDL78862.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] Length = 2280 Score = 71.2 bits (173), Expect = 9e-12 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RW RTNSSLS GSF SNTLSESYQYLS FLSNRTLLDQ Sbjct: 2206 QRWLRTNSSLSNGSFRSNTLSESYQYLSTLFLSNRTLLDQ 2245 >ref|YP_009002298.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] emb|CDL78854.1| Ycf2 (chloroplast) [Pinguicula ehlersiae] Length = 2280 Score = 71.2 bits (173), Expect = 9e-12 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RW RTNSSLS GSF SNTLSESYQYLS FLSNRTLLDQ Sbjct: 2206 QRWLRTNSSLSNGSFRSNTLSESYQYLSTLFLSNRTLLDQ 2245 >ref|YP_009466681.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea violacea] gb|AUN28735.1| hypothetical chloroplast RF21 (chloroplast) [Genlisea violacea] Length = 2288 Score = 71.2 bits (173), Expect = 9e-12 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +2 Query: 209 ERWFRTNSSLSKGSFHSNTLSESYQYLSIFFLSNRTLLDQ 328 +RW RTNSSLS GSF SNTLSESYQYLS FLSNRTLLDQ Sbjct: 2214 QRWLRTNSSLSNGSFRSNTLSESYQYLSTLFLSNRTLLDQ 2253