BLASTX nr result
ID: Rehmannia32_contig00028698
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00028698 (774 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010686465.1| PREDICTED: uncharacterized protein LOC104900... 58 6e-06 >ref|XP_010686465.1| PREDICTED: uncharacterized protein LOC104900672 [Beta vulgaris subsp. vulgaris] Length = 389 Score = 57.8 bits (138), Expect = 6e-06 Identities = 31/82 (37%), Positives = 46/82 (56%), Gaps = 10/82 (12%) Frame = +3 Query: 6 VKEVTVERPDRSSFVQDVYYEFVPRFCTKCKRLGHNTSSCGSGAKAQKK----------E 155 VK++ VE P+ +F Q+V YE+ P FC KC+R+GHN + + A +KK Sbjct: 263 VKQLMVENPNGGTFKQNVVYEWEPVFCKKCQRVGHNCDATVNPAPVKKKWVPKVVPTKPS 322 Query: 156 TIEEATNPPPLVPVKAPMATAS 221 +EEA P+ P K+P A+ S Sbjct: 323 NVEEAPWRQPVRPSKSPTASTS 344