BLASTX nr result
ID: Rehmannia32_contig00028583
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00028583 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020549975.1| uncharacterized protein LOC110012108 isoform... 59 1e-07 >ref|XP_020549975.1| uncharacterized protein LOC110012108 isoform X1 [Sesamum indicum] Length = 422 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/65 (46%), Positives = 39/65 (60%) Frame = +2 Query: 212 RVSVHDIGIIRKNFHIPASYQILIPTTSDRIDKPPPRCLAFHLASFEAGLRFPLARPVVD 391 RV H I RK +HIP+ + ++ P T DR+ +PP AF + +AGLRFPLA PV Sbjct: 104 RVPAHKI---RKKYHIPSDFDVVTPATFDRMHRPPEGFSAFSIKHLDAGLRFPLAPPVAA 160 Query: 392 ILRGL 406 IL L Sbjct: 161 ILNKL 165