BLASTX nr result
ID: Rehmannia32_contig00028540
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00028540 (537 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077474.1| transcription factor MYB3R-3-like isoform X1... 89 3e-17 ref|XP_022869522.1| transcription factor MYB3R-3-like [Olea euro... 85 8e-16 gb|PIN03039.1| Transcription factor, Myb superfamily [Handroanth... 81 1e-14 ref|XP_022882955.1| transcription factor MYB3R-5-like isoform X2... 79 3e-14 ref|XP_022882954.1| transcription factor MYB3R-5-like isoform X1... 79 5e-14 ref|XP_012850221.1| PREDICTED: uncharacterized protein LOC105969... 76 2e-13 gb|EYU26589.1| hypothetical protein MIMGU_mgv1a004217mg [Erythra... 76 9e-13 ref|XP_022853254.1| transcription factor MYB3R-5-like [Olea euro... 72 2e-11 gb|KZV29158.1| hypothetical protein F511_39585 [Dorcoceras hygro... 69 2e-10 >ref|XP_011077474.1| transcription factor MYB3R-3-like isoform X1 [Sesamum indicum] ref|XP_011077475.1| transcription factor MYB3R-3-like isoform X1 [Sesamum indicum] ref|XP_011077476.1| transcription factor MYB3R-3-like isoform X1 [Sesamum indicum] ref|XP_020549498.1| transcription factor MYB3R-3-like isoform X1 [Sesamum indicum] ref|XP_020549499.1| transcription factor MYB3R-3-like isoform X1 [Sesamum indicum] ref|XP_020549500.1| transcription factor MYB3R-3-like isoform X1 [Sesamum indicum] ref|XP_020549501.1| transcription factor MYB3R-3-like isoform X1 [Sesamum indicum] ref|XP_020549502.1| transcription factor MYB3R-3-like isoform X1 [Sesamum indicum] ref|XP_020549503.1| transcription factor MYB3R-3-like isoform X2 [Sesamum indicum] Length = 533 Score = 89.0 bits (219), Expect = 3e-17 Identities = 40/59 (67%), Positives = 49/59 (83%) Frame = +1 Query: 91 PPYRLSFKRNSVIKSIEKQLDFAMNMEQKYKDKNTKSGDSKVKGTPPATKFVYTRQRRG 267 PPYRL FKR SV++S+EKQLDF++N+EQ+ D N KSGDS++K PP TKFVYTR RRG Sbjct: 475 PPYRLRFKRTSVLRSVEKQLDFSINVEQESGDSNAKSGDSELKEIPPVTKFVYTRHRRG 533 >ref|XP_022869522.1| transcription factor MYB3R-3-like [Olea europaea var. sylvestris] Length = 549 Score = 84.7 bits (208), Expect = 8e-16 Identities = 40/58 (68%), Positives = 47/58 (81%) Frame = +1 Query: 91 PPYRLSFKRNSVIKSIEKQLDFAMNMEQKYKDKNTKSGDSKVKGTPPATKFVYTRQRR 264 PPYRL KR SV+KS+EKQL+FA NMEQ+ D+N KS DS V+G PP TKFVYTRQ+R Sbjct: 491 PPYRLRSKRTSVLKSVEKQLEFAFNMEQEGCDQNIKSEDSTVRGIPPVTKFVYTRQKR 548 >gb|PIN03039.1| Transcription factor, Myb superfamily [Handroanthus impetiginosus] Length = 537 Score = 81.3 bits (199), Expect = 1e-14 Identities = 41/58 (70%), Positives = 46/58 (79%) Frame = +1 Query: 91 PPYRLSFKRNSVIKSIEKQLDFAMNMEQKYKDKNTKSGDSKVKGTPPATKFVYTRQRR 264 PPYRLSFKR SV KS+EKQLDFA ME+ + N K+GDS+VK PP TKFVYTRQRR Sbjct: 480 PPYRLSFKRTSVQKSVEKQLDFA-TMEKDSCENNAKTGDSEVKENPPVTKFVYTRQRR 536 >ref|XP_022882955.1| transcription factor MYB3R-5-like isoform X2 [Olea europaea var. sylvestris] Length = 312 Score = 79.0 bits (193), Expect = 3e-14 Identities = 39/58 (67%), Positives = 45/58 (77%) Frame = +1 Query: 91 PPYRLSFKRNSVIKSIEKQLDFAMNMEQKYKDKNTKSGDSKVKGTPPATKFVYTRQRR 264 PPY L KR SV+KS+EKQLDFA MEQ+ ++NT+S DS VK PP TKFVYTRQRR Sbjct: 253 PPYLLRSKRTSVLKSVEKQLDFAFAMEQECCNENTESEDSTVKEIPPVTKFVYTRQRR 310 >ref|XP_022882954.1| transcription factor MYB3R-5-like isoform X1 [Olea europaea var. sylvestris] Length = 352 Score = 79.0 bits (193), Expect = 5e-14 Identities = 39/58 (67%), Positives = 45/58 (77%) Frame = +1 Query: 91 PPYRLSFKRNSVIKSIEKQLDFAMNMEQKYKDKNTKSGDSKVKGTPPATKFVYTRQRR 264 PPY L KR SV+KS+EKQLDFA MEQ+ ++NT+S DS VK PP TKFVYTRQRR Sbjct: 293 PPYLLRSKRTSVLKSVEKQLDFAFAMEQECCNENTESEDSTVKEIPPVTKFVYTRQRR 350 >ref|XP_012850221.1| PREDICTED: uncharacterized protein LOC105969995 isoform X1 [Erythranthe guttata] Length = 231 Score = 75.9 bits (185), Expect = 2e-13 Identities = 38/58 (65%), Positives = 43/58 (74%) Frame = +1 Query: 91 PPYRLSFKRNSVIKSIEKQLDFAMNMEQKYKDKNTKSGDSKVKGTPPATKFVYTRQRR 264 PPYRL FKR SV+KS+EKQLDF ++M D NTKSG + VK PP TKFVYTR RR Sbjct: 178 PPYRLRFKRTSVLKSVEKQLDFDISM-----DNNTKSGGADVKEIPPVTKFVYTRHRR 230 >gb|EYU26589.1| hypothetical protein MIMGU_mgv1a004217mg [Erythranthe guttata] Length = 539 Score = 75.9 bits (185), Expect = 9e-13 Identities = 38/58 (65%), Positives = 43/58 (74%) Frame = +1 Query: 91 PPYRLSFKRNSVIKSIEKQLDFAMNMEQKYKDKNTKSGDSKVKGTPPATKFVYTRQRR 264 PPYRL FKR SV+KS+EKQLDF ++M D NTKSG + VK PP TKFVYTR RR Sbjct: 486 PPYRLRFKRTSVLKSVEKQLDFDISM-----DNNTKSGGADVKEIPPVTKFVYTRHRR 538 >ref|XP_022853254.1| transcription factor MYB3R-5-like [Olea europaea var. sylvestris] Length = 427 Score = 72.0 bits (175), Expect = 2e-11 Identities = 33/58 (56%), Positives = 44/58 (75%) Frame = +1 Query: 91 PPYRLSFKRNSVIKSIEKQLDFAMNMEQKYKDKNTKSGDSKVKGTPPATKFVYTRQRR 264 P Y+L +R SV+KS+EKQLDF +N++Q+ ++ KS D VKG PP TK+VYTRQRR Sbjct: 369 PLYQLRTRRTSVLKSVEKQLDFTLNVDQERCEEKAKSVDLSVKGIPPVTKYVYTRQRR 426 >gb|KZV29158.1| hypothetical protein F511_39585 [Dorcoceras hygrometricum] Length = 557 Score = 68.9 bits (167), Expect = 2e-10 Identities = 36/58 (62%), Positives = 44/58 (75%) Frame = +1 Query: 91 PPYRLSFKRNSVIKSIEKQLDFAMNMEQKYKDKNTKSGDSKVKGTPPATKFVYTRQRR 264 PPYRLSF+RN V+KS+ KQL+FA NM+Q Y +TK +S VK PP TKF YTRQ+R Sbjct: 495 PPYRLSFRRNYVLKSVGKQLNFANNMKQGYCANDTKLENSMVKLIPPFTKF-YTRQKR 551