BLASTX nr result
ID: Rehmannia32_contig00028275
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00028275 (413 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022750517.1| uncharacterized protein LOC111299547 [Durio ... 56 1e-06 >ref|XP_022750517.1| uncharacterized protein LOC111299547 [Durio zibethinus] Length = 201 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -2 Query: 409 SDYRLITRRLVDGRPGLEFSGFSATSVLDHLGSIH 305 ++YRL+T R+VDGRPGL+FSGFSAT +LDHL + H Sbjct: 92 TNYRLVTWRVVDGRPGLKFSGFSATRILDHLSNDH 126