BLASTX nr result
ID: Rehmannia32_contig00028009
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00028009 (591 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN11442.1| hypothetical protein CDL12_15957 [Handroanthus im... 59 5e-07 >gb|PIN11442.1| hypothetical protein CDL12_15957 [Handroanthus impetiginosus] Length = 293 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 5 DNPEVLLRYSSALVQGATNVFWYEPLTIICM 97 DNP+VLL YSSA VQGATNVFWYEPL I CM Sbjct: 105 DNPQVLLHYSSAFVQGATNVFWYEPLPITCM 135