BLASTX nr result
ID: Rehmannia32_contig00027637
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00027637 (386 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020550797.1| nudix hydrolase 8-like isoform X2 [Sesamum i... 62 1e-08 ref|XP_011081301.1| nudix hydrolase 8-like isoform X1 [Sesamum i... 62 1e-08 >ref|XP_020550797.1| nudix hydrolase 8-like isoform X2 [Sesamum indicum] Length = 316 Score = 62.0 bits (149), Expect = 1e-08 Identities = 32/47 (68%), Positives = 38/47 (80%), Gaps = 2/47 (4%) Frame = +1 Query: 250 MEKTLFGSKSLSS--EMMLSTPFLYSRRVVKIGPQFCFCRGILPRAS 384 ME LFGSKSLSS EMMLS+PFL SR+++K+ P C CRGI+PRAS Sbjct: 1 MELKLFGSKSLSSGSEMMLSSPFLNSRQIMKVIPHSCSCRGIVPRAS 47 >ref|XP_011081301.1| nudix hydrolase 8-like isoform X1 [Sesamum indicum] ref|XP_011081302.1| nudix hydrolase 8-like isoform X1 [Sesamum indicum] Length = 355 Score = 62.0 bits (149), Expect = 1e-08 Identities = 32/47 (68%), Positives = 38/47 (80%), Gaps = 2/47 (4%) Frame = +1 Query: 250 MEKTLFGSKSLSS--EMMLSTPFLYSRRVVKIGPQFCFCRGILPRAS 384 ME LFGSKSLSS EMMLS+PFL SR+++K+ P C CRGI+PRAS Sbjct: 1 MELKLFGSKSLSSGSEMMLSSPFLNSRQIMKVIPHSCSCRGIVPRAS 47