BLASTX nr result
ID: Rehmannia32_contig00025622
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00025622 (378 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACN25496.1| unknown [Zea mays] 68 7e-12 gb|ACF82531.1| unknown [Zea mays] 68 7e-12 gb|EYU30575.1| hypothetical protein MIMGU_mgv1a025581mg [Erythra... 69 2e-11 gb|AIU48313.1| minichromosome maintenance 5 protein, partial [Pl... 70 2e-11 gb|AIU48268.1| minichromosome maintenance 5 protein, partial [Ma... 70 2e-11 ref|XP_022888737.1| DNA replication licensing factor MCM5 [Olea ... 70 2e-11 gb|AQK75822.1| DNA replication licensing factor MCM5 [Zea mays] 68 2e-11 gb|AIU48274.1| minichromosome maintenance 5 protein, partial [Sa... 70 3e-11 gb|AIU48295.1| minichromosome maintenance 5 protein, partial [So... 69 4e-11 gb|EYU31799.1| hypothetical protein MIMGU_mgv1a001962mg [Erythra... 69 4e-11 ref|XP_006343693.1| PREDICTED: DNA replication licensing factor ... 69 4e-11 ref|XP_019170508.1| PREDICTED: DNA replication licensing factor ... 69 4e-11 ref|XP_012844156.1| PREDICTED: DNA replication licensing factor ... 69 4e-11 gb|AIU48284.1| minichromosome maintenance 5 protein, partial [Ch... 69 5e-11 gb|AIU48319.1| minichromosome maintenance 5 protein, partial [Ca... 69 5e-11 gb|KMT03581.1| hypothetical protein BVRB_8g192560 [Beta vulgaris... 69 5e-11 gb|AIU48305.1| minichromosome maintenance 5 protein, partial [So... 69 5e-11 gb|OVA12888.1| Mini-chromosome maintenance [Macleaya cordata] 69 5e-11 ref|XP_021741891.1| DNA replication licensing factor MCM5-like [... 69 5e-11 ref|XP_021774329.1| DNA replication licensing factor MCM5-like [... 69 5e-11 >gb|ACN25496.1| unknown [Zea mays] Length = 152 Score = 68.2 bits (165), Expect = 7e-12 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 RMGMNESIVRRALL+MHQRDEVEYKRER VIVRKA Sbjct: 118 RMGMNESIVRRALLIMHQRDEVEYKRERHVIVRKA 152 >gb|ACF82531.1| unknown [Zea mays] Length = 152 Score = 68.2 bits (165), Expect = 7e-12 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 RMGMNESIVRRALL+MHQRDEVEYKRER VIVRKA Sbjct: 118 RMGMNESIVRRALLIMHQRDEVEYKRERHVIVRKA 152 >gb|EYU30575.1| hypothetical protein MIMGU_mgv1a025581mg [Erythranthe guttata] Length = 269 Score = 69.3 bits (168), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 RMGMNESIVRRAL+VMHQRDEVEYKRERRVIVRKA Sbjct: 235 RMGMNESIVRRALVVMHQRDEVEYKRERRVIVRKA 269 >gb|AIU48313.1| minichromosome maintenance 5 protein, partial [Platanus x hispanica] Length = 723 Score = 70.1 bits (170), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 RMGMNESIVRRALL+MHQRDEVEYKRERRVIVRKA Sbjct: 689 RMGMNESIVRRALLIMHQRDEVEYKRERRVIVRKA 723 >gb|AIU48268.1| minichromosome maintenance 5 protein, partial [Magnolia denudata] Length = 723 Score = 70.1 bits (170), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 RMGMNESIVRRALL+MHQRDEVEYKRERRVIVRKA Sbjct: 689 RMGMNESIVRRALLIMHQRDEVEYKRERRVIVRKA 723 >ref|XP_022888737.1| DNA replication licensing factor MCM5 [Olea europaea var. sylvestris] Length = 736 Score = 70.1 bits (170), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 RMGMNESIVRRALL+MHQRDEVEYKRERRVIVRKA Sbjct: 702 RMGMNESIVRRALLIMHQRDEVEYKRERRVIVRKA 736 >gb|AQK75822.1| DNA replication licensing factor MCM5 [Zea mays] Length = 209 Score = 68.2 bits (165), Expect = 2e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 RMGMNESIVRRALL+MHQRDEVEYKRER VIVRKA Sbjct: 175 RMGMNESIVRRALLIMHQRDEVEYKRERHVIVRKA 209 >gb|AIU48274.1| minichromosome maintenance 5 protein, partial [Sarcandra glabra] Length = 723 Score = 69.7 bits (169), Expect = 3e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 RMGMNESIVRRALL+MHQRDEVEYKRERRVI+RKA Sbjct: 689 RMGMNESIVRRALLIMHQRDEVEYKRERRVIIRKA 723 >gb|AIU48295.1| minichromosome maintenance 5 protein, partial [Solanum tuberosum] Length = 723 Score = 69.3 bits (168), Expect = 4e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 RMGMNESIVRRAL++MHQRDEVEYKRERRVIVRKA Sbjct: 689 RMGMNESIVRRALIIMHQRDEVEYKRERRVIVRKA 723 >gb|EYU31799.1| hypothetical protein MIMGU_mgv1a001962mg [Erythranthe guttata] Length = 733 Score = 69.3 bits (168), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 RMGMNESIVRRAL+VMHQRDEVEYKRERRVIVRKA Sbjct: 699 RMGMNESIVRRALVVMHQRDEVEYKRERRVIVRKA 733 >ref|XP_006343693.1| PREDICTED: DNA replication licensing factor MCM5 [Solanum tuberosum] Length = 737 Score = 69.3 bits (168), Expect = 4e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 RMGMNESIVRRAL++MHQRDEVEYKRERRVIVRKA Sbjct: 703 RMGMNESIVRRALIIMHQRDEVEYKRERRVIVRKA 737 >ref|XP_019170508.1| PREDICTED: DNA replication licensing factor MCM5 [Ipomoea nil] Length = 739 Score = 69.3 bits (168), Expect = 4e-11 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 RMGMNESI+RRALL+MHQRDEVEYKRERR+IVRKA Sbjct: 705 RMGMNESIIRRALLIMHQRDEVEYKRERRIIVRKA 739 >ref|XP_012844156.1| PREDICTED: DNA replication licensing factor MCM5 [Erythranthe guttata] Length = 824 Score = 69.3 bits (168), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 RMGMNESIVRRAL+VMHQRDEVEYKRERRVIVRKA Sbjct: 790 RMGMNESIVRRALVVMHQRDEVEYKRERRVIVRKA 824 >gb|AIU48284.1| minichromosome maintenance 5 protein, partial [Chloranthus japonicus] Length = 433 Score = 68.9 bits (167), Expect = 5e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 RMGMNESIVRRALL+MHQRDEVEY+RERRVIVRKA Sbjct: 399 RMGMNESIVRRALLIMHQRDEVEYRRERRVIVRKA 433 >gb|AIU48319.1| minichromosome maintenance 5 protein, partial [Cabomba caroliniana] Length = 493 Score = 68.9 bits (167), Expect = 5e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 +MGMNESIVRRALL+MHQRDEVEYKRERRVIVRKA Sbjct: 459 KMGMNESIVRRALLIMHQRDEVEYKRERRVIVRKA 493 >gb|KMT03581.1| hypothetical protein BVRB_8g192560 [Beta vulgaris subsp. vulgaris] Length = 720 Score = 68.9 bits (167), Expect = 5e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 RMGMN+SIVRRALL+MHQRDEVEYKRERRVIVRKA Sbjct: 686 RMGMNDSIVRRALLIMHQRDEVEYKRERRVIVRKA 720 >gb|AIU48305.1| minichromosome maintenance 5 protein, partial [Solanum lycopersicum] Length = 723 Score = 68.9 bits (167), Expect = 5e-11 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 RMGMNESIVRRAL++MHQRDEVEYKRERRV+VRKA Sbjct: 689 RMGMNESIVRRALIIMHQRDEVEYKRERRVVVRKA 723 >gb|OVA12888.1| Mini-chromosome maintenance [Macleaya cordata] Length = 728 Score = 68.9 bits (167), Expect = 5e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 RMGMNESIVRRALL+MHQRDEVEYKRERRVI+RKA Sbjct: 694 RMGMNESIVRRALLIMHQRDEVEYKRERRVILRKA 728 >ref|XP_021741891.1| DNA replication licensing factor MCM5-like [Chenopodium quinoa] Length = 730 Score = 68.9 bits (167), Expect = 5e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 RMG+NESIVRRALL+MHQRDEVEYKRERRVIVRKA Sbjct: 696 RMGLNESIVRRALLIMHQRDEVEYKRERRVIVRKA 730 >ref|XP_021774329.1| DNA replication licensing factor MCM5-like [Chenopodium quinoa] Length = 730 Score = 68.9 bits (167), Expect = 5e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +2 Query: 20 RMGMNESIVRRALLVMHQRDEVEYKRERRVIVRKA 124 RMG+NESIVRRALL+MHQRDEVEYKRERRVIVRKA Sbjct: 696 RMGLNESIVRRALLIMHQRDEVEYKRERRVIVRKA 730