BLASTX nr result
ID: Rehmannia32_contig00024880
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00024880 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012834286.1| PREDICTED: BTB/POZ domain-containing protein... 73 1e-12 gb|PIN13280.1| hypothetical protein CDL12_14101 [Handroanthus im... 72 5e-12 ref|XP_011073542.1| BTB/POZ domain-containing protein POB1-like ... 72 5e-12 gb|OAY68566.1| BTB/POZ domain-containing protein POB1 [Ananas co... 65 2e-11 ref|XP_010544783.1| PREDICTED: BTB/POZ domain-containing protein... 68 1e-10 gb|ESQ39265.1| hypothetical protein EUTSA_v10001385mg [Eutrema s... 67 1e-10 ref|XP_006397813.1| BTB/POZ domain-containing protein At2g46260 ... 67 1e-10 gb|PKI66260.1| hypothetical protein CRG98_013341 [Punica granatum] 63 2e-10 ref|XP_022721056.1| BTB/POZ domain-containing protein POB1-like ... 67 2e-10 ref|XP_022721050.1| BTB/POZ domain-containing protein POB1-like ... 67 2e-10 gb|KZV31522.1| hypothetical protein F511_07373 [Dorcoceras hygro... 66 5e-10 ref|XP_019576232.1| PREDICTED: BTB/POZ domain-containing protein... 66 5e-10 ref|XP_010506625.1| PREDICTED: BTB/POZ domain-containing protein... 66 5e-10 ref|XP_010506624.1| PREDICTED: BTB/POZ domain-containing protein... 66 5e-10 ref|XP_020091373.1| BTB/POZ domain-containing protein POB1-like ... 65 7e-10 ref|XP_017235984.1| PREDICTED: BTB/POZ domain-containing protein... 65 7e-10 ref|XP_020091367.1| BTB/POZ domain-containing protein POB1-like ... 65 7e-10 ref|XP_018442016.1| PREDICTED: BTB/POZ domain-containing protein... 65 7e-10 gb|OAY63363.1| BTB/POZ domain-containing protein POB1 [Ananas co... 65 7e-10 emb|CAB71090.1| putative protein [Arabidopsis thaliana] 65 1e-09 >ref|XP_012834286.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Erythranthe guttata] gb|EYU40044.1| hypothetical protein MIMGU_mgv1a004127mg [Erythranthe guttata] Length = 543 Score = 73.2 bits (178), Expect = 1e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 265 RNLFG+PWTAFIADDSPYFINGVLHLRAELTIKK Sbjct: 510 RNLFGTPWTAFIADDSPYFINGVLHLRAELTIKK 543 >gb|PIN13280.1| hypothetical protein CDL12_14101 [Handroanthus impetiginosus] Length = 546 Score = 71.6 bits (174), Expect = 5e-12 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 265 RNLFG PWTAFIADDSPYFING+LHLRAELTIKK Sbjct: 513 RNLFGVPWTAFIADDSPYFINGILHLRAELTIKK 546 >ref|XP_011073542.1| BTB/POZ domain-containing protein POB1-like [Sesamum indicum] Length = 546 Score = 71.6 bits (174), Expect = 5e-12 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 265 RNLFG PWTAFIADDSPYFING+LHLRAELTIKK Sbjct: 513 RNLFGVPWTAFIADDSPYFINGILHLRAELTIKK 546 >gb|OAY68566.1| BTB/POZ domain-containing protein POB1 [Ananas comosus] Length = 105 Score = 65.5 bits (158), Expect = 2e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 265 RNLFG PWT+F+A DSPYFINGVLHLRAELTIK+ Sbjct: 59 RNLFGIPWTSFMATDSPYFINGVLHLRAELTIKQ 92 >ref|XP_010544783.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Tarenaya hassleriana] Length = 558 Score = 67.8 bits (164), Expect = 1e-10 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 265 RNLFG PWT+FIA+DSPYFING+LHLRAELTIK+ Sbjct: 520 RNLFGIPWTSFIAEDSPYFINGILHLRAELTIKR 553 >gb|ESQ39265.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum] Length = 530 Score = 67.4 bits (163), Expect = 1e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK*TCL 253 RNLFG PWT+FIADDS YFING+LHLRAELTIK+ T L Sbjct: 493 RNLFGCPWTSFIADDSQYFINGILHLRAELTIKRSTDL 530 >ref|XP_006397813.1| BTB/POZ domain-containing protein At2g46260 [Eutrema salsugineum] gb|ESQ39266.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum] Length = 554 Score = 67.4 bits (163), Expect = 1e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK*TCL 253 RNLFG PWT+FIADDS YFING+LHLRAELTIK+ T L Sbjct: 517 RNLFGCPWTSFIADDSQYFINGILHLRAELTIKRSTDL 554 >gb|PKI66260.1| hypothetical protein CRG98_013341 [Punica granatum] Length = 92 Score = 62.8 bits (151), Expect = 2e-10 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 265 RNLFG PWTAF+ADDS YF+NG LHLRAELTI++ Sbjct: 59 RNLFGIPWTAFMADDSAYFLNGTLHLRAELTIRQ 92 >ref|XP_022721056.1| BTB/POZ domain-containing protein POB1-like isoform X2 [Durio zibethinus] Length = 567 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK*TC 256 RNLFG+PWTAF+ADDS YFING+LHLRAELTI++ C Sbjct: 529 RNLFGTPWTAFMADDSIYFINGILHLRAELTIRQRVC 565 >ref|XP_022721050.1| BTB/POZ domain-containing protein POB1-like isoform X1 [Durio zibethinus] Length = 572 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK*TC 256 RNLFG+PWTAF+ADDS YFING+LHLRAELTI++ C Sbjct: 534 RNLFGTPWTAFMADDSIYFINGILHLRAELTIRQRVC 570 >gb|KZV31522.1| hypothetical protein F511_07373 [Dorcoceras hygrometricum] Length = 552 Score = 65.9 bits (159), Expect = 5e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIK 268 RNLFG PWTAF+ADDSP+FING+LHLRAEL IK Sbjct: 512 RNLFGVPWTAFVADDSPFFINGILHLRAELVIK 544 >ref|XP_019576232.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Rhinolophus sinicus] Length = 559 Score = 65.9 bits (159), Expect = 5e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK*T 259 RNLFG PWT+FIADDS YFING+LHLRAELTIK+ T Sbjct: 521 RNLFGIPWTSFIADDSLYFINGILHLRAELTIKRST 556 >ref|XP_010506625.1| PREDICTED: BTB/POZ domain-containing protein At2g46260 isoform X2 [Camelina sativa] Length = 559 Score = 65.9 bits (159), Expect = 5e-10 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK*TCLN 250 RNLFG PWT+F+A+DSP+FING+LHLRAELTIK+ T L+ Sbjct: 521 RNLFGIPWTSFMAEDSPHFINGILHLRAELTIKRSTDLH 559 >ref|XP_010506624.1| PREDICTED: BTB/POZ domain-containing protein At2g46260 isoform X1 [Camelina sativa] Length = 563 Score = 65.9 bits (159), Expect = 5e-10 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK*TCLN 250 RNLFG PWT+F+A+DSP+FING+LHLRAELTIK+ T L+ Sbjct: 525 RNLFGIPWTSFMAEDSPHFINGILHLRAELTIKRSTDLH 563 >ref|XP_020091373.1| BTB/POZ domain-containing protein POB1-like isoform X2 [Ananas comosus] Length = 547 Score = 65.5 bits (158), Expect = 7e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 265 RNLFG PWT+F+A DSPYFINGVLHLRAELTIK+ Sbjct: 507 RNLFGIPWTSFMATDSPYFINGVLHLRAELTIKQ 540 >ref|XP_017235984.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Daucus carota subsp. sativus] gb|KZN06121.1| hypothetical protein DCAR_006958 [Daucus carota subsp. sativus] Length = 547 Score = 65.5 bits (158), Expect = 7e-10 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 265 RNLFG PWT+F+A+DSPYFING+LHLRAELTI++ Sbjct: 514 RNLFGMPWTSFMAEDSPYFINGILHLRAELTIRQ 547 >ref|XP_020091367.1| BTB/POZ domain-containing protein POB1-like isoform X1 [Ananas comosus] Length = 549 Score = 65.5 bits (158), Expect = 7e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 265 RNLFG PWT+F+A DSPYFINGVLHLRAELTIK+ Sbjct: 509 RNLFGIPWTSFMATDSPYFINGVLHLRAELTIKQ 542 >ref|XP_018442016.1| PREDICTED: BTB/POZ domain-containing protein At2g46260 [Raphanus sativus] ref|XP_018442037.1| PREDICTED: BTB/POZ domain-containing protein At2g46260 [Raphanus sativus] Length = 567 Score = 65.5 bits (158), Expect = 7e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK*TCLN 250 RNLFG PWT+FIA+DS YFING+LHLRAELTIK+ T L+ Sbjct: 529 RNLFGIPWTSFIAEDSQYFINGILHLRAELTIKRSTELH 567 >gb|OAY63363.1| BTB/POZ domain-containing protein POB1 [Ananas comosus] Length = 567 Score = 65.5 bits (158), Expect = 7e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK 265 RNLFG PWT+F+A DSPYFINGVLHLRAELTIK+ Sbjct: 519 RNLFGIPWTSFMATDSPYFINGVLHLRAELTIKQ 552 >emb|CAB71090.1| putative protein [Arabidopsis thaliana] Length = 545 Score = 65.1 bits (157), Expect = 1e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 366 RNLFGSPWTAFIADDSPYFINGVLHLRAELTIKK*T 259 RNLFG PWT+FIA+DS YFING+LHLRAELTIK+ T Sbjct: 508 RNLFGVPWTSFIAEDSQYFINGILHLRAELTIKRST 543