BLASTX nr result
ID: Rehmannia32_contig00022415
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00022415 (577 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN19547.1| hypothetical protein CDL12_07778 [Handroanthus im... 90 3e-19 ref|XP_012839513.1| PREDICTED: 28S ribosomal protein S29, mitoch... 90 2e-17 gb|EYU45994.1| hypothetical protein MIMGU_mgv1a005191mg [Erythra... 90 2e-17 ref|XP_016506938.1| PREDICTED: uncharacterized protein LOC107824... 84 2e-17 ref|XP_011080680.1| uncharacterized protein LOC105163872 isoform... 89 3e-17 gb|PHU16240.1| hypothetical protein BC332_17445 [Capsicum chinense] 86 1e-16 gb|PHT62942.1| Rho GTPase-activating protein 2 [Capsicum annuum] 86 2e-16 ref|XP_016577645.1| PREDICTED: 28S ribosomal protein S29, mitoch... 86 3e-16 ref|XP_009762204.1| PREDICTED: uncharacterized protein LOC104214... 82 8e-16 ref|XP_009354487.1| PREDICTED: 28S ribosomal protein S29, mitoch... 85 1e-15 gb|PKI54662.1| hypothetical protein CRG98_024947 [Punica granatum] 84 1e-15 ref|XP_016512231.1| PREDICTED: uncharacterized protein LOC107829... 84 2e-15 ref|XP_009762267.1| PREDICTED: uncharacterized protein LOC104214... 84 2e-15 ref|XP_009621895.1| PREDICTED: uncharacterized protein LOC104113... 84 2e-15 gb|KHN22778.1| 28S ribosomal protein S29, mitochondrial [Glycine... 83 2e-15 ref|XP_016485559.1| PREDICTED: uncharacterized protein LOC107805... 81 2e-15 ref|XP_009369536.1| PREDICTED: 28S ribosomal protein S29, mitoch... 84 3e-15 ref|XP_007205230.2| 28S ribosomal protein S29, mitochondrial [Pr... 84 3e-15 ref|XP_008230816.1| PREDICTED: 28S ribosomal protein S29, mitoch... 84 3e-15 ref|XP_019178730.1| PREDICTED: 28S ribosomal protein S29, mitoch... 84 3e-15 >gb|PIN19547.1| hypothetical protein CDL12_07778 [Handroanthus impetiginosus] Length = 171 Score = 90.1 bits (222), Expect = 3e-19 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRLV+R AF+EENWKKIFYLSNGNGTEMRYLVPFMR Sbjct: 129 VCHYYLRQRLVKREAFSEENWKKIFYLSNGNGTEMRYLVPFMR 171 >ref|XP_012839513.1| PREDICTED: 28S ribosomal protein S29, mitochondrial [Erythranthe guttata] Length = 463 Score = 89.7 bits (221), Expect = 2e-17 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRLV+R AFTE+NWKKIFYLSNGNGTE+RYLVPFMR Sbjct: 421 VCHYYLRQRLVKRDAFTEDNWKKIFYLSNGNGTELRYLVPFMR 463 >gb|EYU45994.1| hypothetical protein MIMGU_mgv1a005191mg [Erythranthe guttata] Length = 494 Score = 89.7 bits (221), Expect = 2e-17 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRLV+R AFTE+NWKKIFYLSNGNGTE+RYLVPFMR Sbjct: 452 VCHYYLRQRLVKRDAFTEDNWKKIFYLSNGNGTELRYLVPFMR 494 >ref|XP_016506938.1| PREDICTED: uncharacterized protein LOC107824654 [Nicotiana tabacum] Length = 129 Score = 84.0 bits (206), Expect = 2e-17 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRL++R AFTEENWKKI+YLS+GNG EMR+LVPFMR Sbjct: 87 VCHYYLRQRLIQREAFTEENWKKIYYLSHGNGAEMRWLVPFMR 129 >ref|XP_011080680.1| uncharacterized protein LOC105163872 isoform X1 [Sesamum indicum] Length = 452 Score = 89.0 bits (219), Expect = 3e-17 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRLV+R AF+EENWKKIF+LSNGNGTEMRYLVPFMR Sbjct: 410 VCHYYLRQRLVKRDAFSEENWKKIFFLSNGNGTEMRYLVPFMR 452 >gb|PHU16240.1| hypothetical protein BC332_17445 [Capsicum chinense] Length = 322 Score = 86.3 bits (212), Expect = 1e-16 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRL++R AFTEENWKKI+YLSNGNGTE+R+LVPFMR Sbjct: 280 VCHYYLRQRLIQREAFTEENWKKIYYLSNGNGTEIRWLVPFMR 322 >gb|PHT62942.1| Rho GTPase-activating protein 2 [Capsicum annuum] Length = 386 Score = 86.3 bits (212), Expect = 2e-16 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRL++R AFTEENWKKI+YLSNGNGTE+R+LVPFMR Sbjct: 344 VCHYYLRQRLIQREAFTEENWKKIYYLSNGNGTEIRWLVPFMR 386 >ref|XP_016577645.1| PREDICTED: 28S ribosomal protein S29, mitochondrial [Capsicum annuum] Length = 449 Score = 86.3 bits (212), Expect = 3e-16 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRL++R AFTEENWKKI+YLSNGNGTE+R+LVPFMR Sbjct: 407 VCHYYLRQRLIQREAFTEENWKKIYYLSNGNGTEIRWLVPFMR 449 >ref|XP_009762204.1| PREDICTED: uncharacterized protein LOC104214245, partial [Nicotiana sylvestris] Length = 208 Score = 82.0 bits (201), Expect = 8e-16 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRL++R FTEENWKKI+YLS+GNG EMR+LVPFMR Sbjct: 166 VCHYYLRQRLIQREPFTEENWKKIYYLSHGNGAEMRWLVPFMR 208 >ref|XP_009354487.1| PREDICTED: 28S ribosomal protein S29, mitochondrial-like [Pyrus x bretschneideri] Length = 452 Score = 84.7 bits (208), Expect = 1e-15 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRL+RR AFTEENWKK++YLSNGNG EMR+LVP MR Sbjct: 407 VCHYYLRQRLIRREAFTEENWKKVYYLSNGNGAEMRWLVPLMR 449 >gb|PKI54662.1| hypothetical protein CRG98_024947 [Punica granatum] Length = 318 Score = 83.6 bits (205), Expect = 1e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRLVRR AF+EENWKK++YLSNGNG+EMR+L+P MR Sbjct: 276 VCHYYLRQRLVRREAFSEENWKKVYYLSNGNGSEMRWLIPLMR 318 >ref|XP_016512231.1| PREDICTED: uncharacterized protein LOC107829272 [Nicotiana tabacum] Length = 452 Score = 84.0 bits (206), Expect = 2e-15 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRL++R AFTEENWKKI+YLS+GNG EMR+LVPFMR Sbjct: 410 VCHYYLRQRLIQREAFTEENWKKIYYLSHGNGAEMRWLVPFMR 452 >ref|XP_009762267.1| PREDICTED: uncharacterized protein LOC104214314 [Nicotiana sylvestris] Length = 452 Score = 84.0 bits (206), Expect = 2e-15 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRL++R AFTEENWKKI+YLS+GNG EMR+LVPFMR Sbjct: 410 VCHYYLRQRLIQREAFTEENWKKIYYLSHGNGAEMRWLVPFMR 452 >ref|XP_009621895.1| PREDICTED: uncharacterized protein LOC104113438 [Nicotiana tomentosiformis] Length = 452 Score = 84.0 bits (206), Expect = 2e-15 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRL++R AFTEENWKKI+YLS+GNG EMR+LVPFMR Sbjct: 410 VCHYYLRQRLIQREAFTEENWKKIYYLSHGNGAEMRWLVPFMR 452 >gb|KHN22778.1| 28S ribosomal protein S29, mitochondrial [Glycine soja] Length = 319 Score = 82.8 bits (203), Expect = 2e-15 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRL+RR AF+EENWKKI++LSNGNGTE+R LVPFMR Sbjct: 277 VCHYYLRQRLIRREAFSEENWKKIYFLSNGNGTEIRGLVPFMR 319 >ref|XP_016485559.1| PREDICTED: uncharacterized protein LOC107805962, partial [Nicotiana tabacum] Length = 208 Score = 80.9 bits (198), Expect = 2e-15 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRL++R FTEENWKKI+YLS+GNG +MR+LVPFMR Sbjct: 166 VCHYYLRQRLIQREPFTEENWKKIYYLSHGNGAQMRWLVPFMR 208 >ref|XP_009369536.1| PREDICTED: 28S ribosomal protein S29, mitochondrial-like [Pyrus x bretschneideri] Length = 452 Score = 83.6 bits (205), Expect = 3e-15 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRL+RR AFTEENWKK++YLSNGNG EMR+L+P MR Sbjct: 407 VCHYYLRQRLIRREAFTEENWKKVYYLSNGNGAEMRWLLPLMR 449 >ref|XP_007205230.2| 28S ribosomal protein S29, mitochondrial [Prunus persica] gb|ONH99728.1| hypothetical protein PRUPE_6G046100 [Prunus persica] Length = 457 Score = 83.6 bits (205), Expect = 3e-15 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRL+RR AFTEENWKKI+YLSNGNG E+R+LVP MR Sbjct: 407 VCHYYLRQRLIRREAFTEENWKKIYYLSNGNGAEIRWLVPLMR 449 >ref|XP_008230816.1| PREDICTED: 28S ribosomal protein S29, mitochondrial [Prunus mume] Length = 457 Score = 83.6 bits (205), Expect = 3e-15 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRL+RR AFTEENWKKI+YLSNGNG E+R+LVP MR Sbjct: 407 VCHYYLRQRLIRREAFTEENWKKIYYLSNGNGAEIRWLVPLMR 449 >ref|XP_019178730.1| PREDICTED: 28S ribosomal protein S29, mitochondrial [Ipomoea nil] Length = 460 Score = 83.6 bits (205), Expect = 3e-15 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -1 Query: 577 VCHYYLRQRLVRRGAFTEENWKKIFYLSNGNGTEMRYLVPFMR 449 VCHYYLRQRL+RR +F+EENWKKI+YLSNGNG E+R+LVPFMR Sbjct: 418 VCHYYLRQRLIRRESFSEENWKKIYYLSNGNGAELRWLVPFMR 460