BLASTX nr result
ID: Rehmannia32_contig00022403
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00022403 (442 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIA44863.1| hypothetical protein AQUCO_01700439v1 [Aquilegia ... 59 4e-07 gb|PIN14572.1| Ca2+-independent phospholipase A2 [Handroanthus i... 58 5e-07 ref|XP_011082560.1| probable inactive patatin-like protein 9 [Se... 58 5e-07 ref|XP_011079857.1| probable inactive patatin-like protein 9 [Se... 58 7e-07 ref|XP_017239042.1| PREDICTED: probable inactive patatin-like pr... 57 9e-07 gb|KZV51524.1| putative inactive patatin-like protein 9 [Dorcoce... 57 1e-06 gb|PIN18245.1| Ca2+-independent phospholipase A2 [Handroanthus i... 56 2e-06 ref|XP_012832354.1| PREDICTED: probable inactive patatin-like pr... 55 8e-06 >gb|PIA44863.1| hypothetical protein AQUCO_01700439v1 [Aquilegia coerulea] Length = 383 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 98 LTVMELSTLTLEIFSKLEQKWLHHCEGKKTRV 3 +T MELS +TLEIFSKLEQKWL HCEGKKTR+ Sbjct: 6 VTEMELSKITLEIFSKLEQKWLSHCEGKKTRI 37 >gb|PIN14572.1| Ca2+-independent phospholipase A2 [Handroanthus impetiginosus] Length = 378 Score = 58.2 bits (139), Expect = 5e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 89 MELSTLTLEIFSKLEQKWLHHCEGKKTRV 3 MELS +TLEIFSKLEQKWL+HCEGKKTRV Sbjct: 1 MELSKVTLEIFSKLEQKWLYHCEGKKTRV 29 >ref|XP_011082560.1| probable inactive patatin-like protein 9 [Sesamum indicum] Length = 378 Score = 58.2 bits (139), Expect = 5e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 89 MELSTLTLEIFSKLEQKWLHHCEGKKTRV 3 MELS +TLEIFSKLEQKWL+HCEGKKTRV Sbjct: 1 MELSKVTLEIFSKLEQKWLYHCEGKKTRV 29 >ref|XP_011079857.1| probable inactive patatin-like protein 9 [Sesamum indicum] Length = 377 Score = 57.8 bits (138), Expect = 7e-07 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 89 MELSTLTLEIFSKLEQKWLHHCEGKKTRV 3 MEL LTLEIFSKLEQKWLHHCEG KTRV Sbjct: 1 MELDKLTLEIFSKLEQKWLHHCEGTKTRV 29 >ref|XP_017239042.1| PREDICTED: probable inactive patatin-like protein 9 [Daucus carota subsp. sativus] gb|KZN03723.1| hypothetical protein DCAR_012479 [Daucus carota subsp. sativus] Length = 383 Score = 57.4 bits (137), Expect = 9e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 89 MELSTLTLEIFSKLEQKWLHHCEGKKTRV 3 MELS +TLEIFSKLEQKWL+HC+GKKTRV Sbjct: 1 MELSNVTLEIFSKLEQKWLYHCDGKKTRV 29 >gb|KZV51524.1| putative inactive patatin-like protein 9 [Dorcoceras hygrometricum] Length = 375 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 89 MELSTLTLEIFSKLEQKWLHHCEGKKTRV 3 MELS TLEIFSKLEQKWL+HCEGKKTR+ Sbjct: 1 MELSKATLEIFSKLEQKWLYHCEGKKTRI 29 >gb|PIN18245.1| Ca2+-independent phospholipase A2 [Handroanthus impetiginosus] gb|PIN25861.1| Ca2+-independent phospholipase A2 [Handroanthus impetiginosus] Length = 378 Score = 56.2 bits (134), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 89 MELSTLTLEIFSKLEQKWLHHCEGKKTRV 3 ME S +TLEIFSKLE+KWLHHC+GKKTRV Sbjct: 1 MEFSKVTLEIFSKLEKKWLHHCDGKKTRV 29 >ref|XP_012832354.1| PREDICTED: probable inactive patatin-like protein 9 [Erythranthe guttata] gb|EYU46582.1| hypothetical protein MIMGU_mgv1a008290mg [Erythranthe guttata] Length = 378 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -3 Query: 89 MELSTLTLEIFSKLEQKWLHHCEGKKTRV 3 M+LS +T EIF+KLEQKWLHHCEGK+TRV Sbjct: 1 MDLSKVTQEIFTKLEQKWLHHCEGKRTRV 29