BLASTX nr result
ID: Rehmannia32_contig00021920
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00021920 (354 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071844.1| serine/threonine-protein kinase HT1-like [Se... 63 3e-09 gb|PIN15522.1| Tyrosine kinase [Handroanthus impetiginosus] 57 7e-07 gb|KZV34738.1| hypothetical protein F511_00640 [Dorcoceras hygro... 55 2e-06 >ref|XP_011071844.1| serine/threonine-protein kinase HT1-like [Sesamum indicum] Length = 355 Score = 63.2 bits (152), Expect = 3e-09 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 352 QDPEFFSTYEPPEGCAASRCFPTCIAALRSPSLRA 248 QDPEFFS+YEPPEGC+ RC P CIAA RSPSL+A Sbjct: 321 QDPEFFSSYEPPEGCSLVRCIPKCIAARRSPSLQA 355 >gb|PIN15522.1| Tyrosine kinase [Handroanthus impetiginosus] Length = 355 Score = 56.6 bits (135), Expect = 7e-07 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -3 Query: 352 QDPEFFSTYEPPEGCAASRCFPTCIAALRSPSLRA 248 QDPEFFS+YEP EGC S+CFP CI +S SLRA Sbjct: 321 QDPEFFSSYEPAEGCTPSKCFPRCIVDRKSQSLRA 355 >gb|KZV34738.1| hypothetical protein F511_00640 [Dorcoceras hygrometricum] Length = 355 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 352 QDPEFFSTYEPPEGCAASRCFPTCIAALRSPSLRA 248 QDP+FFS+YEPPE RC P CIAA RSPSLRA Sbjct: 321 QDPKFFSSYEPPEDHTLLRCIPKCIAARRSPSLRA 355