BLASTX nr result
ID: Rehmannia32_contig00020430
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00020430 (367 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090543.1| cyclin-dependent kinase C-1 [Sesamum indicum] 62 1e-08 ref|XP_012845335.1| PREDICTED: cyclin-dependent kinase C-1 [Eryt... 61 2e-08 gb|PIN26771.1| Cdc2-related protein kinase [Handroanthus impetig... 60 4e-08 gb|KZV53754.1| cyclin-dependent kinase C-1-like [Dorcoceras hygr... 58 3e-07 >ref|XP_011090543.1| cyclin-dependent kinase C-1 [Sesamum indicum] Length = 512 Score = 62.0 bits (149), Expect = 1e-08 Identities = 28/32 (87%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = +3 Query: 3 PNFSQSGQYGVSGGRGSNPVGGNRNQQY-WQQ 95 PN+SQSGQYGVSGGRG NP GGNRNQQY WQQ Sbjct: 481 PNYSQSGQYGVSGGRGPNPQGGNRNQQYGWQQ 512 >ref|XP_012845335.1| PREDICTED: cyclin-dependent kinase C-1 [Erythranthe guttata] gb|EYU31006.1| hypothetical protein MIMGU_mgv1a004642mg [Erythranthe guttata] Length = 517 Score = 61.2 bits (147), Expect = 2e-08 Identities = 27/32 (84%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = +3 Query: 3 PNFSQSGQYGVSGGRGSNPVGGNRNQQY-WQQ 95 PN++QSGQYGVSGGRG NP GGNRNQQY WQQ Sbjct: 486 PNYTQSGQYGVSGGRGQNPPGGNRNQQYGWQQ 517 >gb|PIN26771.1| Cdc2-related protein kinase [Handroanthus impetiginosus] Length = 511 Score = 60.5 bits (145), Expect = 4e-08 Identities = 27/32 (84%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = +3 Query: 3 PNFSQSGQYGVSGGRGSNPVGGNRNQQY-WQQ 95 PNFSQS QYGVSGGRG NP+GGNRNQQ+ WQQ Sbjct: 480 PNFSQSSQYGVSGGRGPNPMGGNRNQQFGWQQ 511 >gb|KZV53754.1| cyclin-dependent kinase C-1-like [Dorcoceras hygrometricum] Length = 595 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/32 (81%), Positives = 28/32 (87%), Gaps = 1/32 (3%) Frame = +3 Query: 3 PNFSQSGQYGVSGGRGSNPVGGNRNQQY-WQQ 95 PN+ QSGQYGVSGGRG N +GGNRNQQY WQQ Sbjct: 564 PNYPQSGQYGVSGGRGPNQMGGNRNQQYGWQQ 595