BLASTX nr result
ID: Rehmannia32_contig00020419
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00020419 (442 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088398.1| probable LRR receptor-like serine/threonine-... 55 5e-06 >ref|XP_011088398.1| probable LRR receptor-like serine/threonine-protein kinase At2g16250 [Sesamum indicum] Length = 906 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/53 (50%), Positives = 31/53 (58%) Frame = +3 Query: 282 MVDQRSRVVLICLSLFFLLFGCTIEQQFLVXXXXXXXXXXXXXXXXXXXKEWP 440 MVD+ SR+V IC +LFFLLFGCT+EQQFLV KEWP Sbjct: 1 MVDRWSRIVFICSALFFLLFGCTVEQQFLVSRQERLGLLQLRSSLGLRAKEWP 53