BLASTX nr result
ID: Rehmannia32_contig00020378
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00020378 (404 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29299.1| hypothetical protein MIMGU_mgv1a002580mg [Erythra... 56 2e-06 ref|XP_012847188.1| PREDICTED: pentatricopeptide repeat-containi... 56 2e-06 gb|PIN10651.1| hypothetical protein CDL12_16738 [Handroanthus im... 55 3e-06 >gb|EYU29299.1| hypothetical protein MIMGU_mgv1a002580mg [Erythranthe guttata] Length = 657 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 3 DLYRSLTACDAKDEAQSKRIEHVQAFRKLVGI 98 DLYR+LT DAKDE QSKRIEHVQAFR LVGI Sbjct: 625 DLYRTLTESDAKDETQSKRIEHVQAFRNLVGI 656 >ref|XP_012847188.1| PREDICTED: pentatricopeptide repeat-containing protein At4g17616 [Erythranthe guttata] Length = 683 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 3 DLYRSLTACDAKDEAQSKRIEHVQAFRKLVGI 98 DLYR+LT DAKDE QSKRIEHVQAFR LVGI Sbjct: 651 DLYRTLTESDAKDETQSKRIEHVQAFRNLVGI 682 >gb|PIN10651.1| hypothetical protein CDL12_16738 [Handroanthus impetiginosus] Length = 416 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 3 DLYRSLTACDAKDEAQSKRIEHVQAFRKLVGIG 101 DLYR+LT DAKDE QS+RIE+V+AFRKLVGIG Sbjct: 384 DLYRNLTLSDAKDETQSRRIEYVKAFRKLVGIG 416