BLASTX nr result
ID: Rehmannia32_contig00020230
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00020230 (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012844322.1| PREDICTED: probable sugar phosphate/phosphat... 59 9e-08 ref|XP_011082963.1| probable sugar phosphate/phosphate transloca... 59 1e-07 gb|KZV27203.1| putative sugar phosphate/phosphate translocator [... 57 4e-07 >ref|XP_012844322.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Erythranthe guttata] ref|XP_012844323.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Erythranthe guttata] ref|XP_012844324.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Erythranthe guttata] gb|EYU31629.1| hypothetical protein MIMGU_mgv1a005699mg [Erythranthe guttata] Length = 474 Score = 59.3 bits (142), Expect = 9e-08 Identities = 29/53 (54%), Positives = 33/53 (62%) Frame = +1 Query: 196 NKDKRVGIRREPSFSGWCDEDGIPRPARLIXXXXXXXXXXXXLPLVQPHRPEN 354 +K KR+GIRREPSFSGW DEDGIP P++LI LPL Q EN Sbjct: 15 SKVKRIGIRREPSFSGWYDEDGIPYPSQLINDEVNVEEFDFNLPLAQTRSSEN 67 >ref|XP_011082963.1| probable sugar phosphate/phosphate translocator At1g06470 [Sesamum indicum] ref|XP_011082964.1| probable sugar phosphate/phosphate translocator At1g06470 [Sesamum indicum] ref|XP_020550475.1| probable sugar phosphate/phosphate translocator At1g06470 [Sesamum indicum] Length = 500 Score = 58.9 bits (141), Expect = 1e-07 Identities = 32/57 (56%), Positives = 33/57 (57%) Frame = +1 Query: 184 DNLTNKDKRVGIRREPSFSGWCDEDGIPRPARLIXXXXXXXXXXXXLPLVQPHRPEN 354 D LT +DK V I REPSFSGW DEDGIP PARL L LVQP EN Sbjct: 18 DLLTREDKSVRISREPSFSGWFDEDGIPLPARLRNDEVNEEDFVFRLHLVQPQGSEN 74 >gb|KZV27203.1| putative sugar phosphate/phosphate translocator [Dorcoceras hygrometricum] Length = 270 Score = 57.0 bits (136), Expect = 4e-07 Identities = 26/60 (43%), Positives = 36/60 (60%) Frame = +1 Query: 175 TGSDNLTNKDKRVGIRREPSFSGWCDEDGIPRPARLIXXXXXXXXXXXXLPLVQPHRPEN 354 +G +L +++K +G R+PSFSGWCDEDG P++L LPLVQ + PEN Sbjct: 14 SGKGSLRSEEKGLGFGRDPSFSGWCDEDGATHPSQLENNNVNAQELDFDLPLVQKNMPEN 73