BLASTX nr result
ID: Rehmannia32_contig00020192
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00020192 (488 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN18468.1| Acetylglucosaminyltransferase EXT1/exostosin 1 [H... 61 1e-07 >gb|PIN18468.1| Acetylglucosaminyltransferase EXT1/exostosin 1 [Handroanthus impetiginosus] Length = 609 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -1 Query: 104 MRRRQAGILPFGALMEKGQGKNQHSRLCLLASLS 3 MRRRQA ILP LMEKGQGKNQHSRLCLLASLS Sbjct: 1 MRRRQAAILPLRDLMEKGQGKNQHSRLCLLASLS 34