BLASTX nr result
ID: Rehmannia32_contig00018591
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00018591 (544 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN11994.1| hypothetical protein CDL12_15397 [Handroanthus im... 59 3e-07 gb|PIN06910.1| hypothetical protein CDL12_20528 [Handroanthus im... 58 8e-07 >gb|PIN11994.1| hypothetical protein CDL12_15397 [Handroanthus impetiginosus] Length = 265 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 100 DHKPTLGTTIKLNGSNYLLWSRAFQLFLGSQNK 2 ++K TLGTT+KLNG NY+LWS+AF+LFLGSQNK Sbjct: 4 ENKATLGTTVKLNGQNYILWSQAFKLFLGSQNK 36 >gb|PIN06910.1| hypothetical protein CDL12_20528 [Handroanthus impetiginosus] Length = 268 Score = 58.2 bits (139), Expect = 8e-07 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -1 Query: 100 DHKPTLGTTIKLNGSNYLLWSRAFQLFLGSQNK 2 +HK LGTT+KLNG NY+LWS+AF++FLGSQNK Sbjct: 6 EHKLALGTTVKLNGQNYVLWSQAFRMFLGSQNK 38