BLASTX nr result
ID: Rehmannia32_contig00017937
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00017937 (361 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086030.1| transcription factor VOZ1-like isoform X3 [S... 82 7e-16 ref|XP_011086029.1| transcription factor VOZ1-like isoform X2 [S... 82 7e-16 ref|XP_011086027.1| transcription factor VOZ1-like isoform X1 [S... 82 7e-16 ref|XP_011096373.2| transcription factor VOZ1, partial [Sesamum ... 79 2e-14 gb|PIN06039.1| hypothetical protein CDL12_21409 [Handroanthus im... 77 6e-14 gb|PIN15624.1| hypothetical protein CDL12_11731 [Handroanthus im... 74 5e-13 gb|KZV57555.1| hypothetical protein F511_03015 [Dorcoceras hygro... 69 4e-11 emb|CDO99464.1| unnamed protein product [Coffea canephora] 57 4e-07 emb|CDO96711.1| unnamed protein product [Coffea canephora] 55 3e-06 gb|OMO76335.1| hypothetical protein CCACVL1_15744 [Corchorus cap... 55 4e-06 gb|OMO65249.1| hypothetical protein COLO4_31398 [Corchorus olito... 55 4e-06 ref|XP_008371423.1| PREDICTED: uncharacterized protein LOC103434... 54 7e-06 ref|NP_001280853.1| uncharacterized protein LOC103434841 [Malus ... 54 7e-06 ref|XP_008245366.1| PREDICTED: transcription factor VOZ1 [Prunus... 54 1e-05 >ref|XP_011086030.1| transcription factor VOZ1-like isoform X3 [Sesamum indicum] Length = 438 Score = 82.4 bits (202), Expect = 7e-16 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = -1 Query: 361 LKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 233 +KDG G+ YS SNALASPGEGFDYVRGAPYDYLV NINGYYLT Sbjct: 396 MKDGMGSIYSASNALASPGEGFDYVRGAPYDYLVGNINGYYLT 438 >ref|XP_011086029.1| transcription factor VOZ1-like isoform X2 [Sesamum indicum] Length = 477 Score = 82.4 bits (202), Expect = 7e-16 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = -1 Query: 361 LKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 233 +KDG G+ YS SNALASPGEGFDYVRGAPYDYLV NINGYYLT Sbjct: 435 MKDGMGSIYSASNALASPGEGFDYVRGAPYDYLVGNINGYYLT 477 >ref|XP_011086027.1| transcription factor VOZ1-like isoform X1 [Sesamum indicum] ref|XP_011086028.1| transcription factor VOZ1-like isoform X1 [Sesamum indicum] ref|XP_020551529.1| transcription factor VOZ1-like isoform X1 [Sesamum indicum] Length = 486 Score = 82.4 bits (202), Expect = 7e-16 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = -1 Query: 361 LKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 233 +KDG G+ YS SNALASPGEGFDYVRGAPYDYLV NINGYYLT Sbjct: 444 MKDGMGSIYSASNALASPGEGFDYVRGAPYDYLVGNINGYYLT 486 >ref|XP_011096373.2| transcription factor VOZ1, partial [Sesamum indicum] Length = 479 Score = 78.6 bits (192), Expect = 2e-14 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -1 Query: 361 LKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 233 LKDGTGN YS SNAL SP EGFDY RGAPYDYLVD+I+ YYLT Sbjct: 437 LKDGTGNIYSASNALGSPAEGFDYARGAPYDYLVDDISAYYLT 479 >gb|PIN06039.1| hypothetical protein CDL12_21409 [Handroanthus impetiginosus] Length = 489 Score = 77.0 bits (188), Expect = 6e-14 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -1 Query: 358 KDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 233 KDG G++Y NALASPGEG DYVRGAPYDYLVDNI GYYLT Sbjct: 448 KDGNGSSYGAPNALASPGEGVDYVRGAPYDYLVDNIGGYYLT 489 >gb|PIN15624.1| hypothetical protein CDL12_11731 [Handroanthus impetiginosus] Length = 485 Score = 74.3 bits (181), Expect = 5e-13 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -1 Query: 361 LKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 233 L+DG G+ YS SNALASPG+GFD +R A YDYLVDNINGYYLT Sbjct: 443 LRDGNGSIYSASNALASPGDGFDCIRDASYDYLVDNINGYYLT 485 >gb|KZV57555.1| hypothetical protein F511_03015 [Dorcoceras hygrometricum] Length = 454 Score = 68.9 bits (167), Expect = 4e-11 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -1 Query: 361 LKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 233 +KDGTG+ YS SN L+SP E DY +G+PYDYLVDN+NGYYLT Sbjct: 412 VKDGTGSIYSASNQLSSPVEVLDYSKGSPYDYLVDNMNGYYLT 454 >emb|CDO99464.1| unnamed protein product [Coffea canephora] Length = 485 Score = 57.4 bits (137), Expect = 4e-07 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = -1 Query: 358 KDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 233 KD G+ YS N + GEGF+Y GA Y+YLVDN+NGYY+T Sbjct: 444 KDAAGSIYSTPNRMPPTGEGFEYSTGASYEYLVDNLNGYYVT 485 >emb|CDO96711.1| unnamed protein product [Coffea canephora] Length = 354 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/40 (57%), Positives = 28/40 (70%) Frame = -1 Query: 358 KDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYY 239 KD G+ YS N + GEGF+Y GA Y+YLVDN+NGYY Sbjct: 292 KDAAGSIYSTPNRMPPTGEGFEYSTGASYEYLVDNLNGYY 331 >gb|OMO76335.1| hypothetical protein CCACVL1_15744 [Corchorus capsularis] Length = 483 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/42 (59%), Positives = 28/42 (66%) Frame = -1 Query: 358 KDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 233 K G GN YS N +A E FDY G YDYLVDN++GYYLT Sbjct: 442 KVGVGNLYSTPNVVAPTSEKFDYGLGVQYDYLVDNLSGYYLT 483 >gb|OMO65249.1| hypothetical protein COLO4_31398 [Corchorus olitorius] Length = 484 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/42 (59%), Positives = 28/42 (66%) Frame = -1 Query: 358 KDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 233 K G GN YS N +A E FDY G YDYLVDN++GYYLT Sbjct: 443 KVGVGNLYSTPNVVAPTSEKFDYGLGVQYDYLVDNLSGYYLT 484 >ref|XP_008371423.1| PREDICTED: uncharacterized protein LOC103434841 isoform X1 [Malus domestica] ref|XP_008371424.1| PREDICTED: uncharacterized protein LOC103434841 isoform X1 [Malus domestica] ref|XP_008371425.1| PREDICTED: uncharacterized protein LOC103434841 isoform X1 [Malus domestica] Length = 483 Score = 53.9 bits (128), Expect = 7e-06 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = -1 Query: 358 KDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 233 K GN Y N A+ FDY GAPYDYLVDN+NGYYLT Sbjct: 442 KVSVGNVYYAPNRGATTNGTFDYEIGAPYDYLVDNVNGYYLT 483 >ref|NP_001280853.1| uncharacterized protein LOC103434841 [Malus domestica] dbj|BAJ07177.1| MdVOZ1 [Malus domestica] Length = 483 Score = 53.9 bits (128), Expect = 7e-06 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = -1 Query: 358 KDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 233 K GN Y N A+ FDY GAPYDYLVDN+NGYYLT Sbjct: 442 KVSVGNVYYAPNRGATTNGTFDYEIGAPYDYLVDNVNGYYLT 483 >ref|XP_008245366.1| PREDICTED: transcription factor VOZ1 [Prunus mume] ref|XP_008245367.1| PREDICTED: transcription factor VOZ1 [Prunus mume] Length = 484 Score = 53.5 bits (127), Expect = 1e-05 Identities = 25/42 (59%), Positives = 28/42 (66%) Frame = -1 Query: 358 KDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 233 K G GN Y N A+ FDY GAPYDYLV+N+NGYYLT Sbjct: 443 KVGVGNVYYTPNRGATTNGTFDYGIGAPYDYLVENVNGYYLT 484