BLASTX nr result
ID: Rehmannia32_contig00017803
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00017803 (314 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN07041.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase ... 73 2e-13 ref|XP_012828345.1| PREDICTED: uncharacterized protein LOC105949... 60 1e-08 ref|XP_011087855.1| uncharacterized protein LOC105169209 [Sesamu... 53 7e-06 >gb|PIN07041.1| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Handroanthus impetiginosus] Length = 229 Score = 73.2 bits (178), Expect = 2e-13 Identities = 38/50 (76%), Positives = 41/50 (82%) Frame = -2 Query: 151 VENALPLSVSIKQPLSISRPNVISTHFKKDLKSFIANSTLSGDDSSSAET 2 VEN LP VS+KQPLSISR +V+STHFKK KSFIANST S D SSSAET Sbjct: 24 VENPLPFCVSVKQPLSISRSHVVSTHFKKAQKSFIANSTPSDDGSSSAET 73 >ref|XP_012828345.1| PREDICTED: uncharacterized protein LOC105949589 [Erythranthe guttata] gb|EYU18496.1| hypothetical protein MIMGU_mgv1a013037mg [Erythranthe guttata] Length = 232 Score = 60.1 bits (144), Expect = 1e-08 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = -2 Query: 151 VENALPLSVSIKQPLSISRPNVISTHFKKDLKSFIANSTLSGDDSSSAE 5 +ENALPLSVSIKQPL SR ++ S H K+ KSFI NS + DDS++AE Sbjct: 26 LENALPLSVSIKQPLRFSRSHLFSAHSKRAHKSFIVNSAAADDDSAAAE 74 >ref|XP_011087855.1| uncharacterized protein LOC105169209 [Sesamum indicum] Length = 228 Score = 52.8 bits (125), Expect = 7e-06 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = -2 Query: 151 VENALPLSVSIKQPLSISRPNVISTHFKKDLKSFIANSTLSGDDSSSAET 2 V+ LP SVS+K+P ISR +V+STHFKK KSFIAN S D SAET Sbjct: 26 VDTPLPFSVSLKEPRVISRSHVVSTHFKKAHKSFIANCAPSPD---SAET 72