BLASTX nr result
ID: Rehmannia32_contig00017791
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00017791 (686 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN11201.1| hypothetical protein CDL12_16202 [Handroanthus im... 83 2e-17 gb|PIN11951.1| hypothetical protein CDL12_15416 [Handroanthus im... 76 7e-15 >gb|PIN11201.1| hypothetical protein CDL12_16202 [Handroanthus impetiginosus] Length = 43 Score = 82.8 bits (203), Expect = 2e-17 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = -2 Query: 511 MHSVPSSDFLLLTRPHVTSFYGGSSFHRLKHLHKSDRRGNLSS 383 MHSVPS+D LLLTR HVTSFYGGSSFHRLKHL KSDRRGNLSS Sbjct: 1 MHSVPSNDLLLLTRQHVTSFYGGSSFHRLKHLQKSDRRGNLSS 43 >gb|PIN11951.1| hypothetical protein CDL12_15416 [Handroanthus impetiginosus] gb|PIN15072.1| hypothetical protein CDL12_12303 [Handroanthus impetiginosus] Length = 43 Score = 75.9 bits (185), Expect = 7e-15 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -2 Query: 511 MHSVPSSDFLLLTRPHVTSFYGGSSFHRLKHLHKSDRRGNLSS 383 MHSVPS D ++ TRPH+TSFYGGSS HRLKHL KSDRRGN+SS Sbjct: 1 MHSVPSYDLVVFTRPHLTSFYGGSSSHRLKHLQKSDRRGNISS 43