BLASTX nr result
ID: Rehmannia32_contig00017598
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00017598 (438 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN03430.1| hypothetical protein CDL12_24046 [Handroanthus im... 56 3e-07 >gb|PIN03430.1| hypothetical protein CDL12_24046 [Handroanthus impetiginosus] Length = 115 Score = 55.8 bits (133), Expect = 3e-07 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 3/49 (6%) Frame = +1 Query: 301 MRAIGSGISWSLFIVLLIFILHEVRLSMGD---DDGEMVPLVEAGKMEM 438 MRAIG G WSLFI+L I LH+ RLSMG + +MVPLVE GK+EM Sbjct: 1 MRAIGVGFVWSLFILLFICTLHQARLSMGHGLINATDMVPLVEPGKVEM 49