BLASTX nr result
ID: Rehmannia32_contig00017554
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00017554 (1076 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18934.1| hypothetical protein MIMGU_mgv1a013104mg [Erythra... 83 2e-15 ref|XP_012827906.1| PREDICTED: very-long-chain (3R)-3-hydroxyacy... 83 1e-14 gb|PIN23964.1| Protein tyrosine phosphatase-like protein PTPLA (... 82 2e-14 ref|XP_011089419.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehyd... 79 2e-13 ref|XP_022875301.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehyd... 77 1e-12 ref|XP_022875300.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehyd... 77 2e-12 ref|XP_003606497.2| tyrosine phosphatase-like protein PTPLB prot... 76 2e-12 ref|XP_002298376.1| hypothetical protein POPTR_0001s24210g [Popu... 75 4e-12 ref|XP_012064972.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehyd... 74 1e-11 ref|XP_007132108.1| hypothetical protein PHAVU_011G067100g [Phas... 73 2e-11 ref|XP_016482609.1| PREDICTED: very-long-chain (3R)-3-hydroxyacy... 72 2e-11 gb|OAY37853.1| hypothetical protein MANES_11G134400 [Manihot esc... 73 2e-11 dbj|GAV57879.1| PTPLA domain-containing protein [Cephalotus foll... 73 2e-11 gb|AKM76682.1| protein-tyrosine phosphatase-like protein [Pelarg... 73 2e-11 gb|OVA18277.1| Protein-tyrosine phosphatase-like [Macleaya cordata] 73 3e-11 gb|OIV99374.1| hypothetical protein TanjilG_17184 [Lupinus angus... 72 3e-11 gb|KRH29855.1| hypothetical protein GLYMA_11G143000 [Glycine max] 72 3e-11 ref|XP_021628826.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehyd... 73 3e-11 ref|XP_007132106.1| hypothetical protein PHAVU_011G067100g [Phas... 73 3e-11 ref|XP_020214379.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehyd... 73 3e-11 >gb|EYU18934.1| hypothetical protein MIMGU_mgv1a013104mg [Erythranthe guttata] Length = 140 Score = 82.8 bits (203), Expect = 2e-15 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -2 Query: 124 LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 +QELP VFITFVAWS SEVIRYSHYALNC+G PPNWITFIR Sbjct: 20 VQELPSVFITFVAWSFSEVIRYSHYALNCIGTPPNWITFIR 60 >ref|XP_012827906.1| PREDICTED: very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 [Erythranthe guttata] gb|EYU18935.1| hypothetical protein MIMGU_mgv1a013104mg [Erythranthe guttata] Length = 230 Score = 82.8 bits (203), Expect = 1e-14 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -2 Query: 124 LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 +QELP VFITFVAWS SEVIRYSHYALNC+G PPNWITFIR Sbjct: 110 VQELPSVFITFVAWSFSEVIRYSHYALNCIGTPPNWITFIR 150 >gb|PIN23964.1| Protein tyrosine phosphatase-like protein PTPLA (contains Pro instead of catalytic Arg) [Handroanthus impetiginosus] Length = 215 Score = 81.6 bits (200), Expect = 2e-14 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = -2 Query: 124 LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 +QELP VFITF+AWSLSEVIRYSHYALNC+G+PP+WITFIR Sbjct: 95 VQELPSVFITFLAWSLSEVIRYSHYALNCIGSPPDWITFIR 135 >ref|XP_011089419.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 [Sesamum indicum] ref|XP_011089420.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 [Sesamum indicum] ref|XP_011089421.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 [Sesamum indicum] ref|XP_011089422.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 [Sesamum indicum] ref|XP_011097553.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 [Sesamum indicum] ref|XP_011097554.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 [Sesamum indicum] ref|XP_011097555.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 [Sesamum indicum] ref|XP_011097556.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 [Sesamum indicum] ref|XP_020554248.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 [Sesamum indicum] ref|XP_020552258.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 [Sesamum indicum] Length = 215 Score = 79.3 bits (194), Expect = 2e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 124 LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 +QELP VFITFVAWSLSE+IRYSHYALNCLG PNW+TFIR Sbjct: 95 VQELPSVFITFVAWSLSEIIRYSHYALNCLGCSPNWMTFIR 135 >ref|XP_022875301.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 isoform X2 [Olea europaea var. sylvestris] Length = 211 Score = 76.6 bits (187), Expect = 1e-12 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -2 Query: 124 LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 +QELP VFITF AWSLSE+IRYSHYALNCLG PP WIT+ R Sbjct: 92 VQELPSVFITFFAWSLSEIIRYSHYALNCLGTPPYWITYTR 132 >ref|XP_022875300.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 isoform X1 [Olea europaea var. sylvestris] Length = 230 Score = 76.6 bits (187), Expect = 2e-12 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -2 Query: 124 LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 +QELP VFITF AWSLSE+IRYSHYALNCLG PP WIT+ R Sbjct: 92 VQELPSVFITFFAWSLSEIIRYSHYALNCLGTPPYWITYTR 132 >ref|XP_003606497.2| tyrosine phosphatase-like protein PTPLB protein [Medicago truncatula] gb|AFK41133.1| unknown [Medicago truncatula] gb|AES88694.2| tyrosine phosphatase-like protein PTPLB protein [Medicago truncatula] Length = 219 Score = 76.3 bits (186), Expect = 2e-12 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = -2 Query: 124 LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 +QELPPVFITF+AWS+ E+IRYSHYA +CLGN P+WIT+IR Sbjct: 96 VQELPPVFITFLAWSIGEIIRYSHYAFSCLGNCPSWITYIR 136 >ref|XP_002298376.1| hypothetical protein POPTR_0001s24210g [Populus trichocarpa] gb|PNT56244.1| hypothetical protein POPTR_001G235400v3 [Populus trichocarpa] gb|PNT56245.1| hypothetical protein POPTR_001G235400v3 [Populus trichocarpa] gb|PNT56246.1| hypothetical protein POPTR_001G235400v3 [Populus trichocarpa] gb|PNT56247.1| hypothetical protein POPTR_001G235400v3 [Populus trichocarpa] Length = 219 Score = 75.5 bits (184), Expect = 4e-12 Identities = 32/44 (72%), Positives = 41/44 (93%) Frame = -2 Query: 133 LI*LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 +I +QELP VFITFVAWS++EVIRYSHYALNC+G+ P+WIT++R Sbjct: 92 IIEVQELPSVFITFVAWSMAEVIRYSHYALNCVGSCPSWITYLR 135 >ref|XP_012064972.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 [Jatropha curcas] gb|KDP44189.1| hypothetical protein JCGZ_05656 [Jatropha curcas] Length = 218 Score = 73.9 bits (180), Expect = 1e-11 Identities = 30/44 (68%), Positives = 40/44 (90%) Frame = -2 Query: 133 LI*LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 ++ ++ELP VFITF+ WSL+EVIRYSHYALNCLGN P+W+T++R Sbjct: 92 IVEVRELPSVFITFLVWSLAEVIRYSHYALNCLGNCPSWLTYLR 135 >ref|XP_007132108.1| hypothetical protein PHAVU_011G067100g [Phaseolus vulgaris] gb|ESW04102.1| hypothetical protein PHAVU_011G067100g [Phaseolus vulgaris] Length = 177 Score = 72.8 bits (177), Expect = 2e-11 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -2 Query: 124 LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 LQELP VFITF+AWS+ EVIRYSHYA +CLGN P+W+T++R Sbjct: 95 LQELPSVFITFLAWSMGEVIRYSHYAFSCLGNCPSWMTYLR 135 >ref|XP_016482609.1| PREDICTED: very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2-like [Nicotiana tabacum] Length = 140 Score = 71.6 bits (174), Expect = 2e-11 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -2 Query: 133 LI*LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 ++ +QE P VFITF+AWSLSEVIRYSHYAL+C GNPP +IT++R Sbjct: 17 IVEVQESPSVFITFLAWSLSEVIRYSHYALSCTGNPPYFITYLR 60 >gb|OAY37853.1| hypothetical protein MANES_11G134400 [Manihot esculenta] Length = 199 Score = 72.8 bits (177), Expect = 2e-11 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = -2 Query: 139 HFLI*LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 H L+ +QELP +FITF+AW LSEVIRY HYALN +GN P+WIT++R Sbjct: 90 HNLVEVQELPSIFITFLAWCLSEVIRYPHYALNSIGNCPSWITYLR 135 >dbj|GAV57879.1| PTPLA domain-containing protein [Cephalotus follicularis] Length = 219 Score = 73.2 bits (178), Expect = 2e-11 Identities = 30/41 (73%), Positives = 38/41 (92%) Frame = -2 Query: 124 LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 +QELP VF+TF+AWSLSEVIRY+HYALNC+G P+WIT++R Sbjct: 95 VQELPAVFMTFLAWSLSEVIRYTHYALNCIGTCPSWITYLR 135 >gb|AKM76682.1| protein-tyrosine phosphatase-like protein [Pelargonium cotyledonis] Length = 219 Score = 73.2 bits (178), Expect = 2e-11 Identities = 31/44 (70%), Positives = 40/44 (90%) Frame = -2 Query: 133 LI*LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 +I +QELP VFITF+AWSLSE+IRY HYAL+CLG+ P+WIT++R Sbjct: 92 IIEVQELPSVFITFLAWSLSEIIRYPHYALSCLGHCPSWITYLR 135 >gb|OVA18277.1| Protein-tyrosine phosphatase-like [Macleaya cordata] Length = 202 Score = 72.8 bits (177), Expect = 3e-11 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -2 Query: 133 LI*LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 L+ +QELP VFITF AWSLSEVIRYSHYALNC+G P W+T++R Sbjct: 92 LVEIQELPSVFITFFAWSLSEVIRYSHYALNCVGICPFWVTYLR 135 >gb|OIV99374.1| hypothetical protein TanjilG_17184 [Lupinus angustifolius] Length = 186 Score = 72.4 bits (176), Expect = 3e-11 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -2 Query: 124 LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 +QELP VFITF+AWS+SEVIRYSHYA +C GN P+WIT++R Sbjct: 54 VQELPSVFITFLAWSISEVIRYSHYAFSCTGNCPSWITYLR 94 >gb|KRH29855.1| hypothetical protein GLYMA_11G143000 [Glycine max] Length = 188 Score = 72.4 bits (176), Expect = 3e-11 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 124 LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 LQELP VFITF+AWS+ EVIRYSHYA CLGN P+W+T++R Sbjct: 95 LQELPSVFITFLAWSMGEVIRYSHYAFGCLGNCPSWMTYLR 135 >ref|XP_021628826.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 [Manihot esculenta] gb|OAY37854.1| hypothetical protein MANES_11G134400 [Manihot esculenta] Length = 217 Score = 72.8 bits (177), Expect = 3e-11 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = -2 Query: 139 HFLI*LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 H L+ +QELP +FITF+AW LSEVIRY HYALN +GN P+WIT++R Sbjct: 90 HNLVEVQELPSIFITFLAWCLSEVIRYPHYALNSIGNCPSWITYLR 135 >ref|XP_007132106.1| hypothetical protein PHAVU_011G067100g [Phaseolus vulgaris] gb|ESW04100.1| hypothetical protein PHAVU_011G067100g [Phaseolus vulgaris] Length = 218 Score = 72.8 bits (177), Expect = 3e-11 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -2 Query: 124 LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 LQELP VFITF+AWS+ EVIRYSHYA +CLGN P+W+T++R Sbjct: 95 LQELPSVFITFLAWSMGEVIRYSHYAFSCLGNCPSWMTYLR 135 >ref|XP_020214379.1| very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 [Cajanus cajan] gb|KYP68160.1| Protein-tyrosine phosphatase-like member B [Cajanus cajan] Length = 220 Score = 72.8 bits (177), Expect = 3e-11 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -2 Query: 124 LQELPPVFITFVAWSLSEVIRYSHYALNCLGNPPNWITFIR 2 LQELP VFITF+AWS+ EVIRYSHYA +CLGN P+W+T++R Sbjct: 97 LQELPSVFITFLAWSMGEVIRYSHYAFSCLGNCPSWMTYLR 137