BLASTX nr result
ID: Rehmannia32_contig00017242
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00017242 (352 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020554948.1| putative glucose-6-phosphate 1-epimerase [Se... 61 2e-08 ref|XP_021911944.1| LOW QUALITY PROTEIN: putative glucose-6-phos... 56 1e-07 ref|XP_012840543.1| PREDICTED: putative glucose-6-phosphate 1-ep... 59 1e-07 gb|PNX70088.1| glucose-6-phosphate 1-epimerase-like protein, par... 54 2e-07 gb|KHG22925.1| Putative glucose-6-phosphate 1-epimerase [Gossypi... 57 3e-07 gb|OMO59307.1| Aldose 1-/Glucose-6-phosphate 1-epimerase [Corcho... 57 3e-07 ref|XP_016480256.1| PREDICTED: putative glucose-6-phosphate 1-ep... 57 3e-07 ref|XP_008230527.1| PREDICTED: putative glucose-6-phosphate 1-ep... 57 3e-07 ref|XP_017237199.1| PREDICTED: putative glucose-6-phosphate 1-ep... 57 3e-07 gb|PNX73338.1| glucose-6-phosphate 1-epimerase-like protein [Tri... 54 3e-07 ref|XP_022856981.1| putative glucose-6-phosphate 1-epimerase iso... 57 3e-07 ref|XP_021813909.1| putative glucose-6-phosphate 1-epimerase [Pr... 57 3e-07 ref|XP_008230526.1| PREDICTED: putative glucose-6-phosphate 1-ep... 57 3e-07 ref|XP_007215738.1| putative glucose-6-phosphate 1-epimerase [Pr... 57 3e-07 gb|OVA20807.1| Aldose 1-/Glucose-6-phosphate 1-epimerase [Maclea... 57 3e-07 gb|OIT06470.1| hypothetical protein A4A49_24695 [Nicotiana atten... 57 3e-07 ref|XP_016480253.1| PREDICTED: putative glucose-6-phosphate 1-ep... 57 3e-07 ref|XP_009794715.1| PREDICTED: putative glucose-6-phosphate 1-ep... 57 3e-07 ref|XP_009603207.1| PREDICTED: putative glucose-6-phosphate 1-ep... 57 3e-07 gb|KJB75900.1| hypothetical protein B456_012G064600 [Gossypium r... 57 5e-07 >ref|XP_020554948.1| putative glucose-6-phosphate 1-epimerase [Sesamum indicum] Length = 304 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVLGFK 266 EWKGRQEL+ VSSSYCSGQLDPRKVLGFK Sbjct: 276 EWKGRQELTAVSSSYCSGQLDPRKVLGFK 304 >ref|XP_021911944.1| LOW QUALITY PROTEIN: putative glucose-6-phosphate 1-epimerase, partial [Carica papaya] Length = 119 Score = 56.2 bits (134), Expect = 1e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVL 275 EW+GRQELSTVSSSYCSGQLDPRKVL Sbjct: 90 EWRGRQELSTVSSSYCSGQLDPRKVL 115 >ref|XP_012840543.1| PREDICTED: putative glucose-6-phosphate 1-epimerase [Erythranthe guttata] ref|XP_012840544.1| PREDICTED: putative glucose-6-phosphate 1-epimerase [Erythranthe guttata] gb|EYU34743.1| hypothetical protein MIMGU_mgv1a010662mg [Erythranthe guttata] Length = 306 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVLG 272 EWKGRQEL+TVSSSYCSGQLDPRKVLG Sbjct: 278 EWKGRQELTTVSSSYCSGQLDPRKVLG 304 >gb|PNX70088.1| glucose-6-phosphate 1-epimerase-like protein, partial [Trifolium pratense] Length = 48 Score = 53.5 bits (127), Expect = 2e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVL 275 EWKG QELSTVSSSYCSGQLDPR+VL Sbjct: 21 EWKGYQELSTVSSSYCSGQLDPRRVL 46 >gb|KHG22925.1| Putative glucose-6-phosphate 1-epimerase [Gossypium arboreum] Length = 189 Score = 56.6 bits (135), Expect = 3e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVL 275 EWKGRQE+STVSSSYCSGQLDPRKVL Sbjct: 160 EWKGRQEISTVSSSYCSGQLDPRKVL 185 >gb|OMO59307.1| Aldose 1-/Glucose-6-phosphate 1-epimerase [Corchorus capsularis] Length = 259 Score = 57.4 bits (137), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%), Gaps = 1/30 (3%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVL-GFK 266 EWKGRQE+STVSSSYCSGQLDPRKVL GF+ Sbjct: 230 EWKGRQEISTVSSSYCSGQLDPRKVLYGFR 259 >ref|XP_016480256.1| PREDICTED: putative glucose-6-phosphate 1-epimerase isoform X2 [Nicotiana tabacum] Length = 282 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVL 275 EWKGRQELSTVSSSYCSGQLDPRKVL Sbjct: 253 EWKGRQELSTVSSSYCSGQLDPRKVL 278 >ref|XP_008230527.1| PREDICTED: putative glucose-6-phosphate 1-epimerase isoform X2 [Prunus mume] Length = 296 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVL 275 EWKGRQELSTVSSSYCSGQLDPRKVL Sbjct: 267 EWKGRQELSTVSSSYCSGQLDPRKVL 292 >ref|XP_017237199.1| PREDICTED: putative glucose-6-phosphate 1-epimerase [Daucus carota subsp. sativus] ref|XP_017237201.1| PREDICTED: putative glucose-6-phosphate 1-epimerase [Daucus carota subsp. sativus] gb|KZN02503.1| hypothetical protein DCAR_011257 [Daucus carota subsp. sativus] Length = 302 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVL 275 EWKGRQELSTVSSSYCSGQLDPRKVL Sbjct: 273 EWKGRQELSTVSSSYCSGQLDPRKVL 298 >gb|PNX73338.1| glucose-6-phosphate 1-epimerase-like protein [Trifolium pratense] Length = 62 Score = 53.5 bits (127), Expect = 3e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVL 275 EWKG QELSTVSSSYCSGQLDPR+VL Sbjct: 33 EWKGYQELSTVSSSYCSGQLDPRRVL 58 >ref|XP_022856981.1| putative glucose-6-phosphate 1-epimerase isoform X1 [Olea europaea var. sylvestris] Length = 306 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVL 275 EWKGRQELSTVSSSYCSGQLDPRKVL Sbjct: 277 EWKGRQELSTVSSSYCSGQLDPRKVL 302 >ref|XP_021813909.1| putative glucose-6-phosphate 1-epimerase [Prunus avium] Length = 306 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVL 275 EWKGRQELSTVSSSYCSGQLDPRKVL Sbjct: 277 EWKGRQELSTVSSSYCSGQLDPRKVL 302 >ref|XP_008230526.1| PREDICTED: putative glucose-6-phosphate 1-epimerase isoform X1 [Prunus mume] ref|XP_016649479.1| PREDICTED: putative glucose-6-phosphate 1-epimerase isoform X1 [Prunus mume] Length = 306 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVL 275 EWKGRQELSTVSSSYCSGQLDPRKVL Sbjct: 277 EWKGRQELSTVSSSYCSGQLDPRKVL 302 >ref|XP_007215738.1| putative glucose-6-phosphate 1-epimerase [Prunus persica] ref|XP_020415173.1| putative glucose-6-phosphate 1-epimerase [Prunus persica] gb|ONI19702.1| hypothetical protein PRUPE_3G292800 [Prunus persica] Length = 306 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVL 275 EWKGRQELSTVSSSYCSGQLDPRKVL Sbjct: 277 EWKGRQELSTVSSSYCSGQLDPRKVL 302 >gb|OVA20807.1| Aldose 1-/Glucose-6-phosphate 1-epimerase [Macleaya cordata] Length = 307 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVL 275 EWKGRQELSTVSSSYCSGQLDPRKVL Sbjct: 278 EWKGRQELSTVSSSYCSGQLDPRKVL 303 >gb|OIT06470.1| hypothetical protein A4A49_24695 [Nicotiana attenuata] Length = 307 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVL 275 EWKGRQELSTVSSSYCSGQLDPRKVL Sbjct: 278 EWKGRQELSTVSSSYCSGQLDPRKVL 303 >ref|XP_016480253.1| PREDICTED: putative glucose-6-phosphate 1-epimerase isoform X1 [Nicotiana tabacum] ref|XP_016480255.1| PREDICTED: putative glucose-6-phosphate 1-epimerase isoform X1 [Nicotiana tabacum] Length = 307 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVL 275 EWKGRQELSTVSSSYCSGQLDPRKVL Sbjct: 278 EWKGRQELSTVSSSYCSGQLDPRKVL 303 >ref|XP_009794715.1| PREDICTED: putative glucose-6-phosphate 1-epimerase [Nicotiana sylvestris] ref|XP_009794722.1| PREDICTED: putative glucose-6-phosphate 1-epimerase [Nicotiana sylvestris] ref|XP_016484535.1| PREDICTED: putative glucose-6-phosphate 1-epimerase [Nicotiana tabacum] Length = 307 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVL 275 EWKGRQELSTVSSSYCSGQLDPRKVL Sbjct: 278 EWKGRQELSTVSSSYCSGQLDPRKVL 303 >ref|XP_009603207.1| PREDICTED: putative glucose-6-phosphate 1-epimerase [Nicotiana tomentosiformis] Length = 307 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVL 275 EWKGRQELSTVSSSYCSGQLDPRKVL Sbjct: 278 EWKGRQELSTVSSSYCSGQLDPRKVL 303 >gb|KJB75900.1| hypothetical protein B456_012G064600 [Gossypium raimondii] gb|KJB75904.1| hypothetical protein B456_012G064600 [Gossypium raimondii] Length = 259 Score = 56.6 bits (135), Expect = 5e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -1 Query: 352 EWKGRQELSTVSSSYCSGQLDPRKVL 275 EWKGRQE+STVSSSYCSGQLDPRKVL Sbjct: 230 EWKGRQEISTVSSSYCSGQLDPRKVL 255