BLASTX nr result
ID: Rehmannia32_contig00017050
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00017050 (352 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098721.1| ATP-dependent zinc metalloprotease FTSH 4, m... 75 3e-13 ref|XP_011098599.1| ATP-dependent zinc metalloprotease FTSH 4, m... 72 4e-12 ref|XP_012847124.1| PREDICTED: ATP-dependent zinc metalloproteas... 71 6e-12 ref|XP_012847123.1| PREDICTED: ATP-dependent zinc metalloproteas... 71 6e-12 gb|PIN06831.1| AAA+-type ATPase containing the peptidase M41 dom... 63 4e-09 gb|PIN13227.1| AAA+-type ATPase containing the peptidase M41 dom... 62 7e-09 >ref|XP_011098721.1| ATP-dependent zinc metalloprotease FTSH 4, mitochondrial-like [Sesamum indicum] Length = 717 Score = 75.1 bits (183), Expect = 3e-13 Identities = 42/59 (71%), Positives = 47/59 (79%) Frame = +3 Query: 174 MALRRLLSEVKKQESQLRLLSNLAAGPHRTSPYARGAVHKLSGTLGTTTFGKSSNFGSL 350 MALRRLLSEVK+QESQLR LSNLAA P RTSPY AVH+LS + +T G+SS FGSL Sbjct: 1 MALRRLLSEVKRQESQLRQLSNLAARPCRTSPY---AVHELSSNVRASTLGRSSYFGSL 56 >ref|XP_011098599.1| ATP-dependent zinc metalloprotease FTSH 4, mitochondrial-like [Sesamum indicum] Length = 700 Score = 71.6 bits (174), Expect = 4e-12 Identities = 42/59 (71%), Positives = 45/59 (76%) Frame = +3 Query: 174 MALRRLLSEVKKQESQLRLLSNLAAGPHRTSPYARGAVHKLSGTLGTTTFGKSSNFGSL 350 MALRRLLSEVKKQESQLR LSNLAA P RTS Y AVH+LS + +T G SS FGSL Sbjct: 1 MALRRLLSEVKKQESQLRQLSNLAARPCRTSQY---AVHELSSNVRASTLGGSSYFGSL 56 >ref|XP_012847124.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 4, mitochondrial-like isoform X2 [Erythranthe guttata] gb|EYU29326.1| hypothetical protein MIMGU_mgv1a002191mg [Erythranthe guttata] Length = 703 Score = 71.2 bits (173), Expect = 6e-12 Identities = 37/59 (62%), Positives = 42/59 (71%) Frame = +3 Query: 174 MALRRLLSEVKKQESQLRLLSNLAAGPHRTSPYARGAVHKLSGTLGTTTFGKSSNFGSL 350 MALRRLL EVK+QESQL+ LS LAA +R SPYARGA H+L +GT G S FG L Sbjct: 1 MALRRLLGEVKRQESQLKQLSYLAAQSYRVSPYARGAAHRLPSAVGTKPLGGSRYFGGL 59 >ref|XP_012847123.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 4, mitochondrial-like isoform X1 [Erythranthe guttata] Length = 704 Score = 71.2 bits (173), Expect = 6e-12 Identities = 37/59 (62%), Positives = 42/59 (71%) Frame = +3 Query: 174 MALRRLLSEVKKQESQLRLLSNLAAGPHRTSPYARGAVHKLSGTLGTTTFGKSSNFGSL 350 MALRRLL EVK+QESQL+ LS LAA +R SPYARGA H+L +GT G S FG L Sbjct: 1 MALRRLLGEVKRQESQLKQLSYLAAQSYRVSPYARGAAHRLPSAVGTKPLGGSRYFGGL 59 >gb|PIN06831.1| AAA+-type ATPase containing the peptidase M41 domain [Handroanthus impetiginosus] Length = 697 Score = 63.2 bits (152), Expect = 4e-09 Identities = 33/54 (61%), Positives = 40/54 (74%) Frame = +3 Query: 189 LLSEVKKQESQLRLLSNLAAGPHRTSPYARGAVHKLSGTLGTTTFGKSSNFGSL 350 LL +V++QESQLR LSNLAA P+R SPY RG V K S + T+T G+SS F SL Sbjct: 5 LLLQVERQESQLRQLSNLAAPPYRNSPYVRGGVPKPSSSRRTSTLGRSSYFSSL 58 >gb|PIN13227.1| AAA+-type ATPase containing the peptidase M41 domain [Handroanthus impetiginosus] Length = 710 Score = 62.4 bits (150), Expect = 7e-09 Identities = 36/59 (61%), Positives = 41/59 (69%) Frame = +3 Query: 174 MALRRLLSEVKKQESQLRLLSNLAAGPHRTSPYARGAVHKLSGTLGTTTFGKSSNFGSL 350 MALRRLLSEVK+ ESQLR LSNLAA P+ TS YAR GT+ G++S FGSL Sbjct: 1 MALRRLLSEVKRHESQLRQLSNLAARPYLTSRYARAG--------GTSALGRTSYFGSL 51