BLASTX nr result
ID: Rehmannia32_contig00016692
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00016692 (543 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093876.1| 3-oxoacyl-[acyl-carrier-protein] synthase II... 59 5e-07 ref|XP_012851273.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ... 57 4e-06 gb|KZV18258.1| hypothetical protein F511_34071 [Dorcoceras hygro... 56 6e-06 >ref|XP_011093876.1| 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic [Sesamum indicum] Length = 547 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/45 (68%), Positives = 32/45 (71%) Frame = +1 Query: 1 ENPDDIVDTNVLVGPTKERLSIKVALXXXXXXXXXXXXILFAPFQ 135 ENPDD VDTNVLVGPTKERL+IKVAL ILFAPFQ Sbjct: 503 ENPDDGVDTNVLVGPTKERLAIKVALSNSFGFGGHNSSILFAPFQ 547 >ref|XP_012851273.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like [Erythranthe guttata] gb|EYU25822.1| hypothetical protein MIMGU_mgv1a004003mg [Erythranthe guttata] Length = 549 Score = 56.6 bits (135), Expect = 4e-06 Identities = 30/45 (66%), Positives = 31/45 (68%) Frame = +1 Query: 1 ENPDDIVDTNVLVGPTKERLSIKVALXXXXXXXXXXXXILFAPFQ 135 ENPD VDTN+LVGPTKERLSIKVAL ILFAPFQ Sbjct: 505 ENPDTGVDTNLLVGPTKERLSIKVALSNSFGFGGHNSSILFAPFQ 549 >gb|KZV18258.1| hypothetical protein F511_34071 [Dorcoceras hygrometricum] Length = 540 Score = 56.2 bits (134), Expect = 6e-06 Identities = 29/45 (64%), Positives = 31/45 (68%) Frame = +1 Query: 1 ENPDDIVDTNVLVGPTKERLSIKVALXXXXXXXXXXXXILFAPFQ 135 ENPDD VDTNVLVGPTKERL IKVAL ILFAP++ Sbjct: 496 ENPDDGVDTNVLVGPTKERLDIKVALSNSFGFGGQNSSILFAPYK 540