BLASTX nr result
ID: Rehmannia32_contig00016691
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00016691 (542 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089214.1| uncharacterized protein LOC105170241 [Sesamu... 69 1e-11 ref|XP_012835166.1| PREDICTED: uncharacterized protein LOC105955... 66 2e-10 ref|XP_012829649.1| PREDICTED: uncharacterized protein LOC105950... 62 7e-09 ref|XP_012838147.1| PREDICTED: uncharacterized protein LOC105958... 55 2e-06 ref|XP_022872264.1| uncharacterized protein LOC111391301 [Olea e... 54 7e-06 >ref|XP_011089214.1| uncharacterized protein LOC105170241 [Sesamum indicum] Length = 161 Score = 69.3 bits (168), Expect = 1e-11 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 34 RGKNDVVDWDNEMWNRFHGAGFWRSVSQRKDDE 132 RG+NDVVDWDNEMW RF+GAGFWRS S+RKDDE Sbjct: 129 RGENDVVDWDNEMWGRFNGAGFWRSASRRKDDE 161 >ref|XP_012835166.1| PREDICTED: uncharacterized protein LOC105955905 [Erythranthe guttata] Length = 155 Score = 66.2 bits (160), Expect = 2e-10 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 37 GKNDVVDWDNEMWNRFHGAGFWRSVSQRKDDE 132 G+ND VDWDNEMW+RF+GAGFWRS SQR DDE Sbjct: 124 GQNDAVDWDNEMWDRFYGAGFWRSASQRNDDE 155 >ref|XP_012829649.1| PREDICTED: uncharacterized protein LOC105950826 [Erythranthe guttata] Length = 155 Score = 62.0 bits (149), Expect = 7e-09 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 34 RGKNDVVDWDNEMWNRFHGAGFWRSVSQRKDDE 132 RG N+ +DWDNEMW+RF+G GFWRS SQR DDE Sbjct: 123 RGANERLDWDNEMWDRFYGVGFWRSASQRNDDE 155 >ref|XP_012838147.1| PREDICTED: uncharacterized protein LOC105958683 [Erythranthe guttata] Length = 157 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = +1 Query: 34 RGKNDVVDWDNEMWNRFHGAGFWRSVSQRKDDE 132 RGKND V+WD+EMW F+G GFWRS SQR ++ Sbjct: 110 RGKNDAVEWDSEMWELFYGGGFWRSASQRDKEK 142 >ref|XP_022872264.1| uncharacterized protein LOC111391301 [Olea europaea var. sylvestris] Length = 171 Score = 54.3 bits (129), Expect = 7e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +1 Query: 37 GKNDVVDWDNEMWNRFHGAGFWRSVSQRKD 126 GKND VDWD EMW +F+ AGFWRS SQR + Sbjct: 140 GKNDAVDWDKEMWEQFYEAGFWRSASQRAE 169