BLASTX nr result
ID: Rehmannia32_contig00015644
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00015644 (419 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020550461.1| uncharacterized protein LOC105165254 [Sesamu... 54 2e-06 >ref|XP_020550461.1| uncharacterized protein LOC105165254 [Sesamum indicum] Length = 140 Score = 53.9 bits (128), Expect = 2e-06 Identities = 28/59 (47%), Positives = 35/59 (59%) Frame = -3 Query: 273 DEKNEMLFEVSTDSESQHFDGALAPDSGTTAEKDGAQTCNYRSISDCSRMHRLDSGGDD 97 D MLFE S DSE+ FD A +SG AE D AQ+C+Y S+SD +H +D G D Sbjct: 7 DASAYMLFEASGDSEAGFFDAAAEAESGAAAEDD-AQSCSYGSVSDSGAVHGVDDAGGD 64