BLASTX nr result
ID: Rehmannia32_contig00013928
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00013928 (501 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096101.1| homeobox-leucine zipper protein MERISTEM L1 ... 147 5e-38 gb|KZV51409.1| hypothetical protein F511_20573 [Dorcoceras hygro... 146 1e-37 gb|EPS62656.1| hypothetical protein M569_12132 [Genlisea aurea] 145 2e-37 gb|PIN03003.1| hypothetical protein CDL12_24476 [Handroanthus im... 144 5e-37 ref|XP_012848972.1| PREDICTED: homeobox-leucine zipper protein M... 140 1e-35 ref|XP_011086174.2| LOW QUALITY PROTEIN: homeobox-leucine zipper... 137 2e-34 gb|KVI01078.1| Homeodomain-containing protein [Cynara cardunculu... 135 9e-34 ref|XP_022863158.1| homeobox-leucine zipper protein MERISTEM L1-... 135 1e-33 ref|XP_021993721.1| homeobox-leucine zipper protein MERISTEM L1-... 132 2e-32 ref|XP_002266688.1| PREDICTED: homeobox-leucine zipper protein M... 131 2e-32 gb|KVH96954.1| Homeodomain-containing protein [Cynara cardunculu... 130 6e-32 ref|XP_022877991.1| homeobox-leucine zipper protein MERISTEM L1-... 130 6e-32 ref|XP_023751202.1| homeobox-leucine zipper protein MERISTEM L1-... 130 8e-32 ref|XP_023771293.1| homeobox-leucine zipper protein MERISTEM L1-... 129 1e-31 ref|XP_019176002.1| PREDICTED: homeobox-leucine zipper protein M... 129 1e-31 ref|XP_016545426.1| PREDICTED: homeobox-leucine zipper protein M... 128 3e-31 ref|XP_009597904.1| PREDICTED: homeobox-leucine zipper protein M... 127 5e-31 gb|OIT19033.1| homeobox-leucine zipper protein meristem l1, part... 119 9e-31 ref|XP_016486479.1| PREDICTED: homeobox-leucine zipper protein M... 127 9e-31 gb|PHU04447.1| Homeobox-leucine zipper protein MERISTEM L1 [Caps... 127 9e-31 >ref|XP_011096101.1| homeobox-leucine zipper protein MERISTEM L1 [Sesamum indicum] ref|XP_011096102.1| homeobox-leucine zipper protein MERISTEM L1 [Sesamum indicum] ref|XP_011096103.1| homeobox-leucine zipper protein MERISTEM L1 [Sesamum indicum] ref|XP_020554106.1| homeobox-leucine zipper protein MERISTEM L1 [Sesamum indicum] ref|XP_020554107.1| homeobox-leucine zipper protein MERISTEM L1 [Sesamum indicum] Length = 726 Score = 147 bits (371), Expect = 5e-38 Identities = 65/68 (95%), Positives = 68/68 (100%) Frame = +3 Query: 297 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDEQDPNQRPKKKR 476 MFQPN+F+SHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGD+QDPNQRPKKKR Sbjct: 1 MFQPNLFESHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDDQDPNQRPKKKR 60 Query: 477 YHRHTQHQ 500 YHRHTQHQ Sbjct: 61 YHRHTQHQ 68 >gb|KZV51409.1| hypothetical protein F511_20573 [Dorcoceras hygrometricum] Length = 726 Score = 146 bits (368), Expect = 1e-37 Identities = 64/68 (94%), Positives = 68/68 (100%) Frame = +3 Query: 297 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDEQDPNQRPKKKR 476 MFQPNMFDSHHHLLD+GHK+PENE+DLIRDDEYESKSGTDIMEAPSGD+QDPNQRPKKKR Sbjct: 1 MFQPNMFDSHHHLLDLGHKSPENELDLIRDDEYESKSGTDIMEAPSGDDQDPNQRPKKKR 60 Query: 477 YHRHTQHQ 500 YHRHTQHQ Sbjct: 61 YHRHTQHQ 68 >gb|EPS62656.1| hypothetical protein M569_12132 [Genlisea aurea] Length = 712 Score = 145 bits (366), Expect = 2e-37 Identities = 63/68 (92%), Positives = 68/68 (100%) Frame = +3 Query: 297 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDEQDPNQRPKKKR 476 MFQPNMFDSHHHLL+MGHKTPEN++D+IRDDEYESKSGTDIMEAPSGD+QDPNQRPKKKR Sbjct: 1 MFQPNMFDSHHHLLEMGHKTPENDLDIIRDDEYESKSGTDIMEAPSGDDQDPNQRPKKKR 60 Query: 477 YHRHTQHQ 500 YHRHTQHQ Sbjct: 61 YHRHTQHQ 68 >gb|PIN03003.1| hypothetical protein CDL12_24476 [Handroanthus impetiginosus] Length = 726 Score = 144 bits (364), Expect = 5e-37 Identities = 65/68 (95%), Positives = 66/68 (97%) Frame = +3 Query: 297 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDEQDPNQRPKKKR 476 MFQPNMFDSHH LLDM HKTPENEMDLIRDDEYESKSGTDIMEAPSGD+QDPNQRPKKKR Sbjct: 1 MFQPNMFDSHHQLLDMAHKTPENEMDLIRDDEYESKSGTDIMEAPSGDDQDPNQRPKKKR 60 Query: 477 YHRHTQHQ 500 YHRHTQHQ Sbjct: 61 YHRHTQHQ 68 >ref|XP_012848972.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1 [Erythranthe guttata] ref|XP_012848973.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1 [Erythranthe guttata] gb|EYU27818.1| hypothetical protein MIMGU_mgv1a002017mg [Erythranthe guttata] Length = 726 Score = 140 bits (354), Expect = 1e-35 Identities = 67/70 (95%), Positives = 68/70 (97%), Gaps = 2/70 (2%) Frame = +3 Query: 297 MFQPNMFDSHHHLLDMGH-KTPENEMDLIRDDEYESKSGTDIMEAPSGDEQDPNQRP-KK 470 MFQPNMFDSHHHLLDMGH KTPENEMDLIRDD+YESKSGTDIMEAPSGDEQDPNQRP KK Sbjct: 1 MFQPNMFDSHHHLLDMGHNKTPENEMDLIRDDDYESKSGTDIMEAPSGDEQDPNQRPNKK 60 Query: 471 KRYHRHTQHQ 500 KRYHRHTQHQ Sbjct: 61 KRYHRHTQHQ 70 >ref|XP_011086174.2| LOW QUALITY PROTEIN: homeobox-leucine zipper protein MERISTEM L1 [Sesamum indicum] Length = 733 Score = 137 bits (345), Expect = 2e-34 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 1/69 (1%) Frame = +3 Query: 297 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDEQDPNQRP-KKK 473 MFQPN+F+SHHHLLDM HKTPENEMDLIRDDEYESKSGTDIMEAPSGD+QDPNQRP KKK Sbjct: 1 MFQPNIFESHHHLLDMAHKTPENEMDLIRDDEYESKSGTDIMEAPSGDDQDPNQRPNKKK 60 Query: 474 RYHRHTQHQ 500 RY+RHTQHQ Sbjct: 61 RYNRHTQHQ 69 >gb|KVI01078.1| Homeodomain-containing protein [Cynara cardunculus var. scolymus] Length = 694 Score = 135 bits (340), Expect = 9e-34 Identities = 63/70 (90%), Positives = 67/70 (95%), Gaps = 2/70 (2%) Frame = +3 Query: 297 MFQPNMFDSHHH-LLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDEQDPNQRP-KK 470 MFQPNMF+SHHH LLDM HKTPENE+D++RDDEYESKSGTDIMEAPSGDEQDPNQRP KK Sbjct: 1 MFQPNMFESHHHHLLDMSHKTPENELDMLRDDEYESKSGTDIMEAPSGDEQDPNQRPNKK 60 Query: 471 KRYHRHTQHQ 500 KRYHRHTQHQ Sbjct: 61 KRYHRHTQHQ 70 >ref|XP_022863158.1| homeobox-leucine zipper protein MERISTEM L1-like [Olea europaea var. sylvestris] ref|XP_022863159.1| homeobox-leucine zipper protein MERISTEM L1-like [Olea europaea var. sylvestris] Length = 727 Score = 135 bits (339), Expect = 1e-33 Identities = 61/68 (89%), Positives = 64/68 (94%) Frame = +3 Query: 297 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDEQDPNQRPKKKR 476 MFQPNMFDSHH LLDM HK+PENEMDLIRDDE+ESKS TDIMEAPSGD+ DPNQRPKKKR Sbjct: 2 MFQPNMFDSHHSLLDMSHKSPENEMDLIRDDEFESKSVTDIMEAPSGDDGDPNQRPKKKR 61 Query: 477 YHRHTQHQ 500 YHRHTQHQ Sbjct: 62 YHRHTQHQ 69 >ref|XP_021993721.1| homeobox-leucine zipper protein MERISTEM L1-like [Helianthus annuus] ref|XP_021993722.1| homeobox-leucine zipper protein MERISTEM L1-like [Helianthus annuus] gb|OTG08199.1| putative START domain, Homeodomain-like, START-like domain protein [Helianthus annuus] Length = 728 Score = 132 bits (331), Expect = 2e-32 Identities = 59/69 (85%), Positives = 65/69 (94%), Gaps = 1/69 (1%) Frame = +3 Query: 297 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDEQDPNQRP-KKK 473 MFQPNMF+SHHHLLDM HKT ENE+D++RDD+YESKSGTDIMEAPSGD+ DPNQRP KKK Sbjct: 1 MFQPNMFESHHHLLDMSHKTTENELDMLRDDDYESKSGTDIMEAPSGDDLDPNQRPNKKK 60 Query: 474 RYHRHTQHQ 500 RYHRHTQHQ Sbjct: 61 RYHRHTQHQ 69 >ref|XP_002266688.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1 [Vitis vinifera] emb|CBI23181.3| unnamed protein product, partial [Vitis vinifera] Length = 726 Score = 131 bits (330), Expect = 2e-32 Identities = 58/68 (85%), Positives = 64/68 (94%) Frame = +3 Query: 297 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDEQDPNQRPKKKR 476 MFQPNMFDSHHHLLDM HKTPE+EM IRD+E+ESKSGT+ M+APSGD+QDPNQRPKKKR Sbjct: 1 MFQPNMFDSHHHLLDMPHKTPESEMGKIRDEEFESKSGTENMDAPSGDDQDPNQRPKKKR 60 Query: 477 YHRHTQHQ 500 YHRHTQHQ Sbjct: 61 YHRHTQHQ 68 >gb|KVH96954.1| Homeodomain-containing protein [Cynara cardunculus var. scolymus] Length = 622 Score = 130 bits (326), Expect = 6e-32 Identities = 57/69 (82%), Positives = 66/69 (95%), Gaps = 1/69 (1%) Frame = +3 Query: 297 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDEQDPNQRP-KKK 473 MFQPNMF+SHHH+LDM HKTPE+E+D++RD++YESKSGTDIMEA SGD+QDPNQRP KKK Sbjct: 1 MFQPNMFESHHHILDMSHKTPEHELDMLRDEDYESKSGTDIMEAHSGDDQDPNQRPNKKK 60 Query: 474 RYHRHTQHQ 500 RYHRHTQHQ Sbjct: 61 RYHRHTQHQ 69 >ref|XP_022877991.1| homeobox-leucine zipper protein MERISTEM L1-like [Olea europaea var. sylvestris] ref|XP_022877992.1| homeobox-leucine zipper protein MERISTEM L1-like [Olea europaea var. sylvestris] Length = 726 Score = 130 bits (327), Expect = 6e-32 Identities = 59/68 (86%), Positives = 63/68 (92%) Frame = +3 Query: 297 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDEQDPNQRPKKKR 476 MFQPNMFDSHH LLDM HKTPENEMDLI+DDE++SKS TDIMEAPSGD+ DPN RPKKKR Sbjct: 2 MFQPNMFDSHHSLLDMIHKTPENEMDLIKDDEFDSKSVTDIMEAPSGDDGDPNPRPKKKR 61 Query: 477 YHRHTQHQ 500 YHRHTQHQ Sbjct: 62 YHRHTQHQ 69 >ref|XP_023751202.1| homeobox-leucine zipper protein MERISTEM L1-like isoform X1 [Lactuca sativa] ref|XP_023751204.1| homeobox-leucine zipper protein MERISTEM L1-like isoform X1 [Lactuca sativa] ref|XP_023751205.1| homeobox-leucine zipper protein MERISTEM L1-like isoform X1 [Lactuca sativa] ref|XP_023751206.1| homeobox-leucine zipper protein MERISTEM L1-like isoform X1 [Lactuca sativa] ref|XP_023751207.1| homeobox-leucine zipper protein MERISTEM L1-like isoform X1 [Lactuca sativa] gb|PLY95002.1| hypothetical protein LSAT_1X121861 [Lactuca sativa] Length = 730 Score = 130 bits (326), Expect = 8e-32 Identities = 59/71 (83%), Positives = 67/71 (94%), Gaps = 3/71 (4%) Frame = +3 Query: 297 MFQPNMFDSHHH--LLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDEQDPNQRP-K 467 MFQPNMF+SHHH LLDM HK+PEN++D++RDD+YESKSGTDIMEAPSGD+QDPNQRP K Sbjct: 1 MFQPNMFESHHHHHLLDMSHKSPENQLDMLRDDDYESKSGTDIMEAPSGDDQDPNQRPNK 60 Query: 468 KKRYHRHTQHQ 500 KKRYHRHTQHQ Sbjct: 61 KKRYHRHTQHQ 71 >ref|XP_023771293.1| homeobox-leucine zipper protein MERISTEM L1-like [Lactuca sativa] ref|XP_023771295.1| homeobox-leucine zipper protein MERISTEM L1-like [Lactuca sativa] ref|XP_023771301.1| homeobox-leucine zipper protein MERISTEM L1-like [Lactuca sativa] ref|XP_023771310.1| homeobox-leucine zipper protein MERISTEM L1-like [Lactuca sativa] ref|XP_023771319.1| homeobox-leucine zipper protein MERISTEM L1-like [Lactuca sativa] gb|PLY97912.1| hypothetical protein LSAT_4X60501 [Lactuca sativa] Length = 725 Score = 129 bits (325), Expect = 1e-31 Identities = 58/69 (84%), Positives = 64/69 (92%), Gaps = 1/69 (1%) Frame = +3 Query: 297 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDEQDPNQRP-KKK 473 MFQPNMF+SHHH+LDM HK ENE+D++RDD+YESKSGTDIMEA SGDEQDPNQRP KKK Sbjct: 1 MFQPNMFESHHHILDMSHKAQENELDMLRDDDYESKSGTDIMEAHSGDEQDPNQRPNKKK 60 Query: 474 RYHRHTQHQ 500 RYHRHTQHQ Sbjct: 61 RYHRHTQHQ 69 >ref|XP_019176002.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Ipomoea nil] ref|XP_019176003.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Ipomoea nil] ref|XP_019176004.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Ipomoea nil] ref|XP_019176005.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Ipomoea nil] ref|XP_019176006.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Ipomoea nil] ref|XP_019176007.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Ipomoea nil] ref|XP_019176008.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Ipomoea nil] Length = 729 Score = 129 bits (325), Expect = 1e-31 Identities = 58/69 (84%), Positives = 64/69 (92%), Gaps = 1/69 (1%) Frame = +3 Query: 297 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDEQDPN-QRPKKK 473 MFQPNMFD+HHHLLDMGHK PENE+D++RDDE+ESKSGTDIMEAPSGD+QDPN KKK Sbjct: 1 MFQPNMFDTHHHLLDMGHKPPENELDMLRDDEFESKSGTDIMEAPSGDDQDPNLPSNKKK 60 Query: 474 RYHRHTQHQ 500 RYHRHTQHQ Sbjct: 61 RYHRHTQHQ 69 >ref|XP_016545426.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1 [Capsicum annuum] ref|XP_016545427.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1 [Capsicum annuum] gb|PHT69952.1| Homeobox-leucine zipper protein MERISTEM L1 [Capsicum annuum] Length = 731 Score = 128 bits (322), Expect = 3e-31 Identities = 58/68 (85%), Positives = 64/68 (94%) Frame = +3 Query: 297 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDEQDPNQRPKKKR 476 MFQ NMFDSH+ LLDM KTPENE+DLIRDDE+ESKSGTDIMEAPSGD+QDPN+RPKKK+ Sbjct: 1 MFQHNMFDSHNFLLDMTRKTPENELDLIRDDEFESKSGTDIMEAPSGDDQDPNKRPKKKQ 60 Query: 477 YHRHTQHQ 500 YHRHTQHQ Sbjct: 61 YHRHTQHQ 68 >ref|XP_009597904.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana tomentosiformis] ref|XP_018625490.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana tomentosiformis] ref|XP_018625491.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana tomentosiformis] Length = 730 Score = 127 bits (320), Expect = 5e-31 Identities = 57/69 (82%), Positives = 65/69 (94%), Gaps = 1/69 (1%) Frame = +3 Query: 297 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDEQDPNQRP-KKK 473 MFQPNMF+SHHHLLDM HK+PENE+D+IRDDE+++KSGTDIME PSGD+QDPNQRP KKK Sbjct: 1 MFQPNMFESHHHLLDMSHKSPENELDIIRDDEFDTKSGTDIMENPSGDDQDPNQRPNKKK 60 Query: 474 RYHRHTQHQ 500 RYHRHTQ Q Sbjct: 61 RYHRHTQLQ 69 >gb|OIT19033.1| homeobox-leucine zipper protein meristem l1, partial [Nicotiana attenuata] Length = 177 Score = 119 bits (297), Expect = 9e-31 Identities = 55/69 (79%), Positives = 61/69 (88%), Gaps = 1/69 (1%) Frame = +3 Query: 297 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIME-APSGDEQDPNQRPKKK 473 MFQ NMFDSH+ LLD+ HKT ENEMDLIRDDE+ESKSG D E APSGD+QDPN+RPKKK Sbjct: 1 MFQQNMFDSHNFLLDLSHKTSENEMDLIRDDEFESKSGADTTELAPSGDDQDPNKRPKKK 60 Query: 474 RYHRHTQHQ 500 +YHRHTQHQ Sbjct: 61 QYHRHTQHQ 69 >ref|XP_016486479.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana tabacum] ref|XP_016486480.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana tabacum] Length = 730 Score = 127 bits (318), Expect = 9e-31 Identities = 57/69 (82%), Positives = 64/69 (92%), Gaps = 1/69 (1%) Frame = +3 Query: 297 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDEQDPNQRP-KKK 473 MFQPNMF+SHHHLLDM HK+PENE+D IRDDE+++KSGTDIME PSGD+QDPNQRP KKK Sbjct: 1 MFQPNMFESHHHLLDMSHKSPENELDFIRDDEFDTKSGTDIMENPSGDDQDPNQRPNKKK 60 Query: 474 RYHRHTQHQ 500 RYHRHTQ Q Sbjct: 61 RYHRHTQLQ 69 >gb|PHU04447.1| Homeobox-leucine zipper protein MERISTEM L1 [Capsicum chinense] Length = 731 Score = 127 bits (318), Expect = 9e-31 Identities = 57/68 (83%), Positives = 64/68 (94%) Frame = +3 Query: 297 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDEQDPNQRPKKKR 476 MFQ NMFDSH+ LLD+ KTPENE+DLIRDDE+ESKSGTDIMEAPSGD+QDPN+RPKKK+ Sbjct: 1 MFQHNMFDSHNFLLDVTRKTPENELDLIRDDEFESKSGTDIMEAPSGDDQDPNKRPKKKQ 60 Query: 477 YHRHTQHQ 500 YHRHTQHQ Sbjct: 61 YHRHTQHQ 68