BLASTX nr result
ID: Rehmannia32_contig00013827
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00013827 (490 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010028662.1| PREDICTED: uncharacterized protein LOC104418... 61 1e-09 gb|PIN14270.1| hypothetical protein CDL12_13092 [Handroanthus im... 60 3e-09 gb|KCW55434.1| hypothetical protein EUGRSUZ_I01336, partial [Euc... 61 4e-09 gb|EYU40413.1| hypothetical protein MIMGU_mgv1a0189651mg, partia... 59 5e-09 gb|PKI37217.1| hypothetical protein CRG98_042408 [Punica granatum] 59 7e-09 ref|XP_022876197.1| uncharacterized protein LOC111394562 [Olea e... 59 7e-09 gb|PIM99838.1| hypothetical protein CDL12_27663 [Handroanthus im... 59 7e-09 ref|XP_020420573.1| uncharacterized protein LOC109949443 [Prunus... 59 7e-09 ref|XP_018501421.1| PREDICTED: uncharacterized protein LOC103940... 59 7e-09 ref|XP_018497784.1| PREDICTED: uncharacterized protein LOC103967... 59 7e-09 ref|XP_017255727.1| PREDICTED: uncharacterized protein LOC108225... 59 7e-09 ref|XP_017239561.1| PREDICTED: uncharacterized protein LOC108212... 59 7e-09 gb|KVI04135.1| ATPase, F0 complex, subunit E, mitochondrial [Cyn... 59 7e-09 ref|XP_012833739.1| PREDICTED: uncharacterized protein LOC105954... 59 7e-09 ref|XP_011088539.1| uncharacterized protein LOC105169741 [Sesamu... 59 7e-09 ref|XP_008466504.1| PREDICTED: uncharacterized protein LOC103503... 59 7e-09 ref|XP_006423528.1| uncharacterized protein LOC18034539 [Citrus ... 59 7e-09 ref|XP_010271417.1| PREDICTED: uncharacterized protein LOC104607... 58 1e-08 ref|XP_022132454.1| uncharacterized protein LOC111005275 [Momord... 58 2e-08 ref|XP_006473622.1| PREDICTED: uncharacterized protein LOC102619... 58 2e-08 >ref|XP_010028662.1| PREDICTED: uncharacterized protein LOC104418890 [Eucalyptus grandis] Length = 53 Score = 60.8 bits (146), Expect = 1e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 MAPPPGPYSG STLALVARVSAFTFG+AYG Sbjct: 1 MAPPPGPYSGTSTLALVARVSAFTFGVAYG 30 >gb|PIN14270.1| hypothetical protein CDL12_13092 [Handroanthus impetiginosus] Length = 53 Score = 60.1 bits (144), Expect = 3e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 MAPPPGPYSGKSTLALVARVSAFT GL YG Sbjct: 1 MAPPPGPYSGKSTLALVARVSAFTVGLVYG 30 >gb|KCW55434.1| hypothetical protein EUGRSUZ_I01336, partial [Eucalyptus grandis] Length = 96 Score = 60.8 bits (146), Expect = 4e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 MAPPPGPYSG STLALVARVSAFTFG+AYG Sbjct: 44 MAPPPGPYSGTSTLALVARVSAFTFGVAYG 73 >gb|EYU40413.1| hypothetical protein MIMGU_mgv1a0189651mg, partial [Erythranthe guttata] Length = 38 Score = 58.9 bits (141), Expect = 5e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 M PPGPYSGKSTLALVARVSAFTFGLAYG Sbjct: 1 MTLPPGPYSGKSTLALVARVSAFTFGLAYG 30 >gb|PKI37217.1| hypothetical protein CRG98_042408 [Punica granatum] Length = 53 Score = 58.9 bits (141), Expect = 7e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 MAPPPGPYSG STLALVARVSAF+FGL YG Sbjct: 1 MAPPPGPYSGTSTLALVARVSAFSFGLVYG 30 >ref|XP_022876197.1| uncharacterized protein LOC111394562 [Olea europaea var. sylvestris] Length = 53 Score = 58.9 bits (141), Expect = 7e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 MAPPPGPYSG STLALVARVSAF+FGL YG Sbjct: 1 MAPPPGPYSGTSTLALVARVSAFSFGLVYG 30 >gb|PIM99838.1| hypothetical protein CDL12_27663 [Handroanthus impetiginosus] Length = 53 Score = 58.9 bits (141), Expect = 7e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 MAPPPGPYSG STLALVARVSAF+FGL YG Sbjct: 1 MAPPPGPYSGTSTLALVARVSAFSFGLVYG 30 >ref|XP_020420573.1| uncharacterized protein LOC109949443 [Prunus persica] gb|ONI32450.1| hypothetical protein PRUPE_1G368600 [Prunus persica] Length = 53 Score = 58.9 bits (141), Expect = 7e-09 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 MAPPPGPYSG STLALVAR SAFTFGL YG Sbjct: 1 MAPPPGPYSGTSTLALVARASAFTFGLVYG 30 >ref|XP_018501421.1| PREDICTED: uncharacterized protein LOC103940819 [Pyrus x bretschneideri] Length = 53 Score = 58.9 bits (141), Expect = 7e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 MAPPPGPYSG STLALVARVSAF+FGL YG Sbjct: 1 MAPPPGPYSGTSTLALVARVSAFSFGLVYG 30 >ref|XP_018497784.1| PREDICTED: uncharacterized protein LOC103967958 [Pyrus x bretschneideri] Length = 53 Score = 58.9 bits (141), Expect = 7e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 MAPPPGPYSG STLALVARVSAF+FGL YG Sbjct: 1 MAPPPGPYSGTSTLALVARVSAFSFGLVYG 30 >ref|XP_017255727.1| PREDICTED: uncharacterized protein LOC108225389 [Daucus carota subsp. sativus] Length = 53 Score = 58.9 bits (141), Expect = 7e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 MAPPPGPYSG STLALVARVSAF+FGL YG Sbjct: 1 MAPPPGPYSGTSTLALVARVSAFSFGLVYG 30 >ref|XP_017239561.1| PREDICTED: uncharacterized protein LOC108212343 [Daucus carota subsp. sativus] Length = 53 Score = 58.9 bits (141), Expect = 7e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 MAPPPGPYSG STLALVARVSAF+FGL YG Sbjct: 1 MAPPPGPYSGTSTLALVARVSAFSFGLVYG 30 >gb|KVI04135.1| ATPase, F0 complex, subunit E, mitochondrial [Cynara cardunculus var. scolymus] Length = 53 Score = 58.9 bits (141), Expect = 7e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 MAPPPGPYSG STLALVARVSAF+FGL YG Sbjct: 1 MAPPPGPYSGTSTLALVARVSAFSFGLVYG 30 >ref|XP_012833739.1| PREDICTED: uncharacterized protein LOC105954621 [Erythranthe guttata] Length = 53 Score = 58.9 bits (141), Expect = 7e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 M PPGPYSGKSTLALVARVSAFTFGLAYG Sbjct: 1 MTLPPGPYSGKSTLALVARVSAFTFGLAYG 30 >ref|XP_011088539.1| uncharacterized protein LOC105169741 [Sesamum indicum] Length = 53 Score = 58.9 bits (141), Expect = 7e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 MAPPPGPYSG STLALVARVSAF+FGL YG Sbjct: 1 MAPPPGPYSGTSTLALVARVSAFSFGLVYG 30 >ref|XP_008466504.1| PREDICTED: uncharacterized protein LOC103503894 [Cucumis melo] Length = 53 Score = 58.9 bits (141), Expect = 7e-09 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 MAPPPGPYSG STLALVAR SAFTFGL YG Sbjct: 1 MAPPPGPYSGTSTLALVARASAFTFGLVYG 30 >ref|XP_006423528.1| uncharacterized protein LOC18034539 [Citrus clementina] ref|XP_006487285.1| PREDICTED: uncharacterized protein LOC102627696 [Citrus sinensis] gb|ESR36768.1| hypothetical protein CICLE_v10029771mg [Citrus clementina] gb|KDO46690.1| hypothetical protein CISIN_1g035398mg [Citrus sinensis] Length = 53 Score = 58.9 bits (141), Expect = 7e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 MAPPPGPYSG STLALVARVSAF+FGL YG Sbjct: 1 MAPPPGPYSGTSTLALVARVSAFSFGLVYG 30 >ref|XP_010271417.1| PREDICTED: uncharacterized protein LOC104607478 [Nelumbo nucifera] Length = 53 Score = 58.2 bits (139), Expect = 1e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 MAPPPGPYSG STLALVAR SAFTFG+ YG Sbjct: 1 MAPPPGPYSGTSTLALVARASAFTFGIVYG 30 >ref|XP_022132454.1| uncharacterized protein LOC111005275 [Momordica charantia] Length = 53 Score = 57.8 bits (138), Expect = 2e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 MAPPPGPYSG STLALVAR SAFTFG+ YG Sbjct: 1 MAPPPGPYSGTSTLALVARASAFTFGVVYG 30 >ref|XP_006473622.1| PREDICTED: uncharacterized protein LOC102619089 [Citrus sinensis] ref|XP_006473623.1| PREDICTED: uncharacterized protein LOC102619089 [Citrus sinensis] ref|XP_006473624.1| PREDICTED: uncharacterized protein LOC102619089 [Citrus sinensis] ref|XP_006473625.1| PREDICTED: uncharacterized protein LOC102619089 [Citrus sinensis] ref|XP_006473626.1| PREDICTED: uncharacterized protein LOC102619089 [Citrus sinensis] ref|XP_024040407.1| uncharacterized protein LOC18042396 [Citrus clementina] ref|XP_024040408.1| uncharacterized protein LOC18042396 [Citrus clementina] ref|XP_024040409.1| uncharacterized protein LOC18042396 [Citrus clementina] gb|ESR48384.1| hypothetical protein CICLE_v10003088mg [Citrus clementina] gb|KDO84790.1| hypothetical protein CISIN_1g0354532mg [Citrus sinensis] gb|KDO84791.1| hypothetical protein CISIN_1g0354532mg [Citrus sinensis] Length = 53 Score = 57.8 bits (138), Expect = 2e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 99 MAPPPGPYSGKSTLALVARVSAFTFGLAYG 188 MAPPPGPYSG STLALVAR SAFTFG+ YG Sbjct: 1 MAPPPGPYSGTSTLALVARASAFTFGVVYG 30