BLASTX nr result
ID: Rehmannia32_contig00013767
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00013767 (585 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN07127.1| hypothetical protein CDL12_20309 [Handroanthus im... 70 9e-11 ref|XP_011078748.1| E3 ubiquitin-protein ligase ATL6 [Sesamum in... 65 9e-09 >gb|PIN07127.1| hypothetical protein CDL12_20309 [Handroanthus impetiginosus] Length = 399 Score = 70.5 bits (171), Expect = 9e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -3 Query: 583 EAGESSGTSRTPVKMPSFKCLEPKAADETGLFSGEPDRHPV 461 EAGESSG+SRTPVKMPSFKCLEPKAADE GLFS P R V Sbjct: 359 EAGESSGSSRTPVKMPSFKCLEPKAADEAGLFSDHPARPAV 399 >ref|XP_011078748.1| E3 ubiquitin-protein ligase ATL6 [Sesamum indicum] Length = 390 Score = 64.7 bits (156), Expect = 9e-09 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = -3 Query: 583 EAGESSGTSRTPVKMPSFKCLEPKAADETGLFSGEPDRHPV 461 E G+ G+SRTPVKMPSFKCLEPKAADET L S P R PV Sbjct: 350 ETGDGVGSSRTPVKMPSFKCLEPKAADETSLISDNPGRPPV 390