BLASTX nr result
ID: Rehmannia32_contig00013728
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00013728 (378 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN27034.1| CREB binding protein/P300 [Handroanthus impetigin... 72 3e-12 gb|PIN25520.1| CREB binding protein/P300 [Handroanthus impetigin... 70 1e-11 ref|XP_020552136.1| BTB/POZ and TAZ domain-containing protein 1 ... 67 8e-11 ref|XP_011086988.1| BTB/POZ and TAZ domain-containing protein 1 ... 67 1e-10 emb|CDP15082.1| unnamed protein product [Coffea canephora] 67 3e-10 ref|XP_002511276.1| PREDICTED: BTB/POZ and TAZ domain-containing... 66 5e-10 gb|KRH57172.1| hypothetical protein GLYMA_05G043800 [Glycine max] 60 7e-10 emb|CBI14900.3| unnamed protein product, partial [Vitis vinifera] 65 9e-10 ref|XP_002278192.3| PREDICTED: BTB/POZ and TAZ domain-containing... 65 9e-10 gb|PIN18300.1| CREB binding protein/P300 [Handroanthus impetigin... 64 2e-09 gb|KHN10463.1| BTB/POZ and TAZ domain-containing protein 2 [Glyc... 62 2e-09 ref|XP_009631253.1| PREDICTED: BTB/POZ and TAZ domain-containing... 63 3e-09 ref|XP_009631252.1| PREDICTED: BTB/POZ and TAZ domain-containing... 63 4e-09 gb|OMP09209.1| Zinc finger, TAZ-type [Corchorus olitorius] 63 4e-09 ref|XP_019247443.1| PREDICTED: BTB/POZ and TAZ domain-containing... 62 8e-09 ref|XP_022889905.1| BTB/POZ and TAZ domain-containing protein 1-... 62 8e-09 ref|XP_010250936.1| PREDICTED: BTB/POZ and TAZ domain-containing... 62 8e-09 ref|XP_010250935.1| PREDICTED: BTB/POZ and TAZ domain-containing... 62 8e-09 ref|XP_003549831.3| PREDICTED: BTB/POZ and TAZ domain-containing... 62 1e-08 ref|XP_009767207.1| PREDICTED: BTB/POZ and TAZ domain-containing... 62 1e-08 >gb|PIN27034.1| CREB binding protein/P300 [Handroanthus impetiginosus] Length = 359 Score = 72.0 bits (175), Expect = 3e-12 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -2 Query: 377 QHDRRGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAM 252 Q DRRGNDARWRLLV+KVVSARA+SSLSLPKR+REE+ R+ M Sbjct: 308 QQDRRGNDARWRLLVKKVVSARAISSLSLPKRKREEEQRMGM 349 >gb|PIN25520.1| CREB binding protein/P300 [Handroanthus impetiginosus] Length = 359 Score = 70.5 bits (171), Expect = 1e-11 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = -2 Query: 377 QHDRRGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAM 252 Q DRRGNDARWRLL++KVVSARA+SSLSLPKR+RE++ R+ M Sbjct: 308 QQDRRGNDARWRLLIKKVVSARAISSLSLPKRKREQEQRMGM 349 >ref|XP_020552136.1| BTB/POZ and TAZ domain-containing protein 1 isoform X3 [Sesamum indicum] Length = 262 Score = 67.4 bits (163), Expect = 8e-11 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -2 Query: 377 QHDRRGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHN 246 Q R G+D RWRLLVRKV SA+AMSSLSLPKR+REE+PR+ M N Sbjct: 210 QDPRGGSDERWRLLVRKVASAKAMSSLSLPKRKREEEPRMGMDN 253 >ref|XP_011086988.1| BTB/POZ and TAZ domain-containing protein 1 isoform X1 [Sesamum indicum] Length = 353 Score = 67.4 bits (163), Expect = 1e-10 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -2 Query: 377 QHDRRGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHN 246 Q R G+D RWRLLVRKV SA+AMSSLSLPKR+REE+PR+ M N Sbjct: 301 QDPRGGSDERWRLLVRKVASAKAMSSLSLPKRKREEEPRMGMDN 344 >emb|CDP15082.1| unnamed protein product [Coffea canephora] Length = 355 Score = 66.6 bits (161), Expect = 3e-10 Identities = 29/52 (55%), Positives = 44/52 (84%) Frame = -2 Query: 377 QHDRRGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI*NYVL 222 Q +++G DARW+LLVRKV+SA+A+SSLSLPKR+REE+PR+ + + + ++ L Sbjct: 304 QQEKKGEDARWKLLVRKVISAKALSSLSLPKRKREEEPRLNLSHPGMRSFTL 355 >ref|XP_002511276.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1 [Ricinus communis] gb|EEF51878.1| protein binding protein, putative [Ricinus communis] Length = 363 Score = 65.9 bits (159), Expect = 5e-10 Identities = 30/47 (63%), Positives = 40/47 (85%) Frame = -2 Query: 377 QHDRRGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI 237 QH+++G+DA W+LLVRKVVSAR +SSLSLPKR+REEQ + +H+ I Sbjct: 312 QHEKKGDDALWKLLVRKVVSARVLSSLSLPKRKREEQLKETIHDHGI 358 >gb|KRH57172.1| hypothetical protein GLYMA_05G043800 [Glycine max] Length = 54 Score = 60.5 bits (145), Expect = 7e-10 Identities = 28/52 (53%), Positives = 41/52 (78%) Frame = -2 Query: 377 QHDRRGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI*NYVL 222 Q ++R +DA+W+LL RKV SA+ MSSLSLPKR+R+E+ RV ++N I ++ L Sbjct: 2 QQEKRKDDAKWKLLARKVASAKVMSSLSLPKRKRDEETRVNINNPGIRSFKL 53 >emb|CBI14900.3| unnamed protein product, partial [Vitis vinifera] Length = 347 Score = 65.1 bits (157), Expect = 9e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -2 Query: 377 QHDRRGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPR 261 Q ++G DARW+LLVRKVVSA+AMSSLSLPKR+REE+PR Sbjct: 295 QQVKKGEDARWKLLVRKVVSAKAMSSLSLPKRKREEEPR 333 >ref|XP_002278192.3| PREDICTED: BTB/POZ and TAZ domain-containing protein 1 [Vitis vinifera] Length = 351 Score = 65.1 bits (157), Expect = 9e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -2 Query: 377 QHDRRGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPR 261 Q ++G DARW+LLVRKVVSA+AMSSLSLPKR+REE+PR Sbjct: 299 QQVKKGEDARWKLLVRKVVSAKAMSSLSLPKRKREEEPR 337 >gb|PIN18300.1| CREB binding protein/P300 [Handroanthus impetiginosus] Length = 364 Score = 64.3 bits (155), Expect = 2e-09 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -2 Query: 377 QHDRRGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAM 252 Q DRR +D RW LLVRKV SA+A+SSLSLPKR+REE PR+AM Sbjct: 313 QQDRRKSDERWTLLVRKVSSAKAISSLSLPKRKREEDPRMAM 354 >gb|KHN10463.1| BTB/POZ and TAZ domain-containing protein 2 [Glycine soja] Length = 166 Score = 62.0 bits (149), Expect = 2e-09 Identities = 29/52 (55%), Positives = 40/52 (76%) Frame = -2 Query: 377 QHDRRGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI*NYVL 222 Q ++R +DA+W+LL RKV SA+ MSSLSLPKR+R+E+ RV M N I ++ L Sbjct: 114 QQEKRKDDAKWKLLARKVASAKVMSSLSLPKRKRDEETRVTMDNPGIRSFKL 165 >ref|XP_009631253.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like isoform X2 [Nicotiana tomentosiformis] ref|XP_016462366.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like isoform X2 [Nicotiana tabacum] Length = 284 Score = 63.2 bits (152), Expect = 3e-09 Identities = 30/48 (62%), Positives = 40/48 (83%) Frame = -2 Query: 365 RGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI*NYVL 222 RG+D W+ LVRKVVSARAMSSLSLPKR+REE+PR+ + + + N++L Sbjct: 235 RGDDELWKSLVRKVVSARAMSSLSLPKRKREEEPRMDLSHHRVINFML 282 >ref|XP_009631252.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like isoform X1 [Nicotiana tomentosiformis] ref|XP_016462365.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like isoform X1 [Nicotiana tabacum] ref|XP_018621988.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like isoform X1 [Nicotiana tomentosiformis] Length = 346 Score = 63.2 bits (152), Expect = 4e-09 Identities = 30/48 (62%), Positives = 40/48 (83%) Frame = -2 Query: 365 RGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI*NYVL 222 RG+D W+ LVRKVVSARAMSSLSLPKR+REE+PR+ + + + N++L Sbjct: 297 RGDDELWKSLVRKVVSARAMSSLSLPKRKREEEPRMDLSHHRVINFML 344 >gb|OMP09209.1| Zinc finger, TAZ-type [Corchorus olitorius] Length = 359 Score = 63.2 bits (152), Expect = 4e-09 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = -2 Query: 377 QHDRRGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI*NYVL 222 Q + G+DA W+LLVRKV+SA+AMSSLSLPKR+REE+ R M I N++L Sbjct: 308 QQQKLGDDALWKLLVRKVLSAKAMSSLSLPKRKREEEVRETMGGQMIRNFIL 359 >ref|XP_019247443.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Nicotiana attenuata] gb|OIT02177.1| btbpoz and taz domain-containing protein 1 [Nicotiana attenuata] Length = 349 Score = 62.4 bits (150), Expect = 8e-09 Identities = 30/49 (61%), Positives = 40/49 (81%) Frame = -2 Query: 368 RRGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI*NYVL 222 +RG+D W+ LVRKVVSARAMSSLSLPKR+REE+PR+ + + + N+ L Sbjct: 299 QRGDDELWKSLVRKVVSARAMSSLSLPKRKREEEPRMYLSHHQVINFSL 347 >ref|XP_022889905.1| BTB/POZ and TAZ domain-containing protein 1-like [Olea europaea var. sylvestris] Length = 350 Score = 62.4 bits (150), Expect = 8e-09 Identities = 28/41 (68%), Positives = 37/41 (90%) Frame = -2 Query: 377 QHDRRGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPRVA 255 Q ++RG+DARWRLLVRKV SA+ +SSLSLPKR+RE++P +A Sbjct: 296 QQNKRGDDARWRLLVRKVASAKLISSLSLPKRKREDKPWIA 336 >ref|XP_010250936.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like isoform X2 [Nelumbo nucifera] Length = 368 Score = 62.4 bits (150), Expect = 8e-09 Identities = 29/43 (67%), Positives = 38/43 (88%) Frame = -2 Query: 377 QHDRRGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMH 249 Q +++G+DARWRLLVR+V+SA+AM SLSL KR+REE PR A+H Sbjct: 314 QLEKKGDDARWRLLVRRVMSAKAMYSLSLSKRKREEGPREAIH 356 >ref|XP_010250935.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like isoform X1 [Nelumbo nucifera] Length = 369 Score = 62.4 bits (150), Expect = 8e-09 Identities = 29/43 (67%), Positives = 38/43 (88%) Frame = -2 Query: 377 QHDRRGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMH 249 Q +++G+DARWRLLVR+V+SA+AM SLSL KR+REE PR A+H Sbjct: 315 QLEKKGDDARWRLLVRRVMSAKAMYSLSLSKRKREEGPREAIH 357 >ref|XP_003549831.3| PREDICTED: BTB/POZ and TAZ domain-containing protein 1 [Glycine max] gb|KRH03892.1| hypothetical protein GLYMA_17G126400 [Glycine max] Length = 346 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/52 (55%), Positives = 40/52 (76%) Frame = -2 Query: 377 QHDRRGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI*NYVL 222 Q ++R +DA+W+LL RKV SA+ MSSLSLPKR+R+E+ RV M N I ++ L Sbjct: 294 QQEKRKDDAKWKLLARKVASAKVMSSLSLPKRKRDEETRVTMDNPGIRSFKL 345 >ref|XP_009767207.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Nicotiana sylvestris] ref|XP_016496185.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Nicotiana tabacum] Length = 374 Score = 62.0 bits (149), Expect = 1e-08 Identities = 30/49 (61%), Positives = 40/49 (81%) Frame = -2 Query: 368 RRGNDARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI*NYVL 222 +RG+D W+ LVRKVVSARAMSSLSLPKR+REE+PR+ + + + N+ L Sbjct: 324 QRGDDELWKSLVRKVVSARAMSSLSLPKRKREEEPRMNLSHHQVINFRL 372