BLASTX nr result
ID: Rehmannia32_contig00013386
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00013386 (418 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012846219.1| PREDICTED: uncharacterized protein LOC105966... 60 8e-08 ref|XP_011077211.1| myb family transcription factor EFM-like [Se... 58 4e-07 gb|PIN23693.1| hypothetical protein CDL12_03586 [Handroanthus im... 55 3e-06 ref|XP_011070832.1| myb family transcription factor EFM [Sesamum... 55 5e-06 gb|PIN09501.1| hypothetical protein CDL12_17921 [Handroanthus im... 55 6e-06 >ref|XP_012846219.1| PREDICTED: uncharacterized protein LOC105966198 [Erythranthe guttata] gb|EYU29947.1| hypothetical protein MIMGU_mgv1a008281mg [Erythranthe guttata] Length = 379 Score = 60.1 bits (144), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 211 DSPRKVAVTEVKRNGGGGAFHPFKKEK 131 DSPRKVAVTEVKRNGGGGAFHPFKKEK Sbjct: 138 DSPRKVAVTEVKRNGGGGAFHPFKKEK 164 >ref|XP_011077211.1| myb family transcription factor EFM-like [Sesamum indicum] Length = 391 Score = 58.2 bits (139), Expect = 4e-07 Identities = 29/37 (78%), Positives = 29/37 (78%) Frame = -1 Query: 211 DSPRKVAVTEVKRNGGGGAFHPFKKEKISCVGPSGNA 101 DSPRKVAV EVKRNGG GAFHPFKKEK S G G A Sbjct: 146 DSPRKVAVVEVKRNGGSGAFHPFKKEK-STAGDDGTA 181 >gb|PIN23693.1| hypothetical protein CDL12_03586 [Handroanthus impetiginosus] Length = 383 Score = 55.5 bits (132), Expect = 3e-06 Identities = 29/45 (64%), Positives = 29/45 (64%) Frame = -1 Query: 211 DSPRKVAVTEVKRNGGGGAFHPFKKEKISCVGPSGNAVITTTKRP 77 DSPRKVAV EVKR G GGAFHPFKKEK V G T RP Sbjct: 142 DSPRKVAVVEVKRTGSGGAFHPFKKEK--SVSSGGATAEPPTNRP 184 >ref|XP_011070832.1| myb family transcription factor EFM [Sesamum indicum] Length = 393 Score = 55.1 bits (131), Expect = 5e-06 Identities = 27/45 (60%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = -1 Query: 208 SPRKVAVTEVKRNGGGGAFHPFKKEK-ISCVGPSGNAVITTTKRP 77 SPRKVAV EVKRNG GGAFHPFKKEK ++ PS + + P Sbjct: 150 SPRKVAVMEVKRNGSGGAFHPFKKEKSVATTAPSQGPAVNKSVPP 194 >gb|PIN09501.1| hypothetical protein CDL12_17921 [Handroanthus impetiginosus] Length = 392 Score = 54.7 bits (130), Expect = 6e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -1 Query: 211 DSPRKVAVTEVKRNGGGGAFHPFKKEK 131 DSP+KVAVTEVKR+G GGAFHPFKKEK Sbjct: 149 DSPKKVAVTEVKRSGSGGAFHPFKKEK 175