BLASTX nr result
ID: Rehmannia32_contig00011754
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00011754 (553 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099851.1| pentatricopeptide repeat-containing protein ... 70 1e-10 ref|XP_022845911.1| pentatricopeptide repeat-containing protein ... 64 1e-08 gb|PIN15031.1| hypothetical protein CDL12_12337 [Handroanthus im... 64 1e-08 ref|XP_012571624.1| PREDICTED: pentatricopeptide repeat-containi... 62 8e-08 ref|XP_004501623.1| PREDICTED: pentatricopeptide repeat-containi... 62 9e-08 ref|XP_002283907.4| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 emb|CAN80524.1| hypothetical protein VITISV_030537 [Vitis vinifera] 61 1e-07 gb|OMO77960.1| hypothetical protein COLO4_24918 [Corchorus olito... 61 2e-07 ref|XP_016163692.1| pentatricopeptide repeat-containing protein ... 60 2e-07 ref|XP_015934861.1| pentatricopeptide repeat-containing protein ... 60 2e-07 gb|EYU27007.1| hypothetical protein MIMGU_mgv1a005508mg [Erythra... 60 3e-07 ref|XP_012849792.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_019156410.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_015900972.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_015900970.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 gb|OMO98439.1| hypothetical protein CCACVL1_04225 [Corchorus cap... 60 4e-07 gb|EEF30142.1| pentatricopeptide repeat-containing protein, puta... 60 4e-07 ref|XP_002532248.2| PREDICTED: pentatricopeptide repeat-containi... 60 5e-07 ref|XP_021667276.1| pentatricopeptide repeat-containing protein ... 59 6e-07 ref|XP_019156414.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 >ref|XP_011099851.1| pentatricopeptide repeat-containing protein At5g18475 [Sesamum indicum] Length = 515 Score = 69.7 bits (169), Expect = 1e-10 Identities = 38/59 (64%), Positives = 43/59 (72%) Frame = -1 Query: 553 AIFLHKLAQYKKYQSLDAVLHQMTYETCKFHEDISICSVGHLHESISF*AKVVRRTSNI 377 AI LHKLAQ KKYQSLDAVLHQMTYETCKFHE I + + H +S S KV+ S+I Sbjct: 99 AIILHKLAQCKKYQSLDAVLHQMTYETCKFHEGIFLNLMKHFSKS-SMHEKVLEMFSSI 156 >ref|XP_022845911.1| pentatricopeptide repeat-containing protein At5g18475 isoform X1 [Olea europaea var. sylvestris] ref|XP_022845912.1| pentatricopeptide repeat-containing protein At5g18475 isoform X2 [Olea europaea var. sylvestris] Length = 510 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = -1 Query: 553 AIFLHKLAQYKKYQSLDAVLHQMTYETCKFHEDISICSVGHLHES 419 AI LHKLAQ KKYQSLD VLHQMTYETCKF E I + + H +S Sbjct: 94 AIILHKLAQCKKYQSLDTVLHQMTYETCKFQEGIFLNLMKHFSKS 138 >gb|PIN15031.1| hypothetical protein CDL12_12337 [Handroanthus impetiginosus] Length = 513 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -1 Query: 553 AIFLHKLAQYKKYQSLDAVLHQMTYETCKFHEDISICSVGHLHES 419 A+ LHKLAQ KKYQSL AVLH+MTYETCKFHE I + + H +S Sbjct: 96 AVILHKLAQSKKYQSLGAVLHRMTYETCKFHEGIFLNLMKHFSKS 140 >ref|XP_012571624.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X2 [Cicer arietinum] Length = 410 Score = 61.6 bits (148), Expect = 8e-08 Identities = 31/53 (58%), Positives = 39/53 (73%) Frame = -1 Query: 553 AIFLHKLAQYKKYQSLDAVLHQMTYETCKFHEDISICSVGHLHESISF*AKVV 395 A LHKLAQ+KK+Q++D VLHQMTYETC+FHE I I + H + SF KV+ Sbjct: 94 ASILHKLAQFKKFQAVDRVLHQMTYETCQFHEGIFINLMKH-YSKCSFHEKVL 145 >ref|XP_004501623.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X1 [Cicer arietinum] ref|XP_004501624.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X1 [Cicer arietinum] ref|XP_012571621.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X1 [Cicer arietinum] ref|XP_012571623.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X1 [Cicer arietinum] Length = 510 Score = 61.6 bits (148), Expect = 9e-08 Identities = 31/53 (58%), Positives = 39/53 (73%) Frame = -1 Query: 553 AIFLHKLAQYKKYQSLDAVLHQMTYETCKFHEDISICSVGHLHESISF*AKVV 395 A LHKLAQ+KK+Q++D VLHQMTYETC+FHE I I + H + SF KV+ Sbjct: 94 ASILHKLAQFKKFQAVDRVLHQMTYETCQFHEGIFINLMKH-YSKCSFHEKVL 145 >ref|XP_002283907.4| PREDICTED: pentatricopeptide repeat-containing protein At5g18475 [Vitis vinifera] Length = 513 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/51 (58%), Positives = 37/51 (72%), Gaps = 5/51 (9%) Frame = -1 Query: 553 AIFLHKLAQYKKYQSLDAVLHQMTYETCKFHEDISICSVGH-----LHESI 416 A LHKLA+ KK+Q++DAVLHQMTYETCKFHE I + + H LHE + Sbjct: 97 ATILHKLAKSKKFQAIDAVLHQMTYETCKFHEGIFLNLMKHFSKLSLHERV 147 >emb|CAN80524.1| hypothetical protein VITISV_030537 [Vitis vinifera] Length = 714 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/51 (58%), Positives = 37/51 (72%), Gaps = 5/51 (9%) Frame = -1 Query: 553 AIFLHKLAQYKKYQSLDAVLHQMTYETCKFHEDISICSVGH-----LHESI 416 A LHKLA+ KK+Q++DAVLHQMTYETCKFHE I + + H LHE + Sbjct: 167 ATILHKLAKSKKFQAIDAVLHQMTYETCKFHEGIFLNLMKHFSKLSLHERV 217 >gb|OMO77960.1| hypothetical protein COLO4_24918 [Corchorus olitorius] Length = 515 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -1 Query: 550 IFLHKLAQYKKYQSLDAVLHQMTYETCKFHEDISICSVGH 431 + LHKLAQ KK+Q++D++LHQMTYETCKFHE I I + H Sbjct: 100 VILHKLAQSKKFQAIDSILHQMTYETCKFHEGIFINLMRH 139 >ref|XP_016163692.1| pentatricopeptide repeat-containing protein At5g18475 [Arachis ipaensis] ref|XP_016163694.1| pentatricopeptide repeat-containing protein At5g18475 [Arachis ipaensis] ref|XP_020962154.1| pentatricopeptide repeat-containing protein At5g18475 [Arachis ipaensis] ref|XP_020962156.1| pentatricopeptide repeat-containing protein At5g18475 [Arachis ipaensis] ref|XP_020962157.1| pentatricopeptide repeat-containing protein At5g18475 [Arachis ipaensis] ref|XP_020962158.1| pentatricopeptide repeat-containing protein At5g18475 [Arachis ipaensis] ref|XP_020962159.1| pentatricopeptide repeat-containing protein At5g18475 [Arachis ipaensis] Length = 517 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = -1 Query: 550 IFLHKLAQYKKYQSLDAVLHQMTYETCKFHEDISICSVGHLHES 419 I L KLAQ KK+Q++D VLHQMTYETCKFHE I I + HL +S Sbjct: 102 IILEKLAQSKKFQAVDRVLHQMTYETCKFHEGIFINLMKHLSKS 145 >ref|XP_015934861.1| pentatricopeptide repeat-containing protein At5g18475 [Arachis duranensis] ref|XP_020984505.1| pentatricopeptide repeat-containing protein At5g18475 [Arachis duranensis] Length = 517 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = -1 Query: 550 IFLHKLAQYKKYQSLDAVLHQMTYETCKFHEDISICSVGHLHES 419 I L KLAQ KK+Q++D VLHQMTYETCKFHE I I + HL +S Sbjct: 102 IILEKLAQSKKFQAVDRVLHQMTYETCKFHEGIFINLMKHLSKS 145 >gb|EYU27007.1| hypothetical protein MIMGU_mgv1a005508mg [Erythranthe guttata] Length = 481 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = -1 Query: 553 AIFLHKLAQYKKYQSLDAVLHQMTYETCKFHEDISICSVGHLHES 419 A+ LHKLAQ K YQS+DAVLH+M+YETC+FHE + + + H +S Sbjct: 93 AVILHKLAQCKNYQSVDAVLHRMSYETCEFHEGVFLNLMRHFSKS 137 >ref|XP_012849792.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475 [Erythranthe guttata] Length = 507 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = -1 Query: 553 AIFLHKLAQYKKYQSLDAVLHQMTYETCKFHEDISICSVGHLHES 419 A+ LHKLAQ K YQS+DAVLH+M+YETC+FHE + + + H +S Sbjct: 93 AVILHKLAQCKNYQSVDAVLHRMSYETCEFHEGVFLNLMRHFSKS 137 >ref|XP_019156410.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X1 [Ipomoea nil] ref|XP_019156411.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X1 [Ipomoea nil] ref|XP_019156412.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X1 [Ipomoea nil] ref|XP_019156413.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X1 [Ipomoea nil] Length = 516 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/51 (58%), Positives = 36/51 (70%), Gaps = 5/51 (9%) Frame = -1 Query: 553 AIFLHKLAQYKKYQSLDAVLHQMTYETCKFHEDISICSVGH-----LHESI 416 AI LHKLA +++Q +DAVLHQMTYETCKFHE I I + H LHE + Sbjct: 97 AIILHKLAACRRFQMVDAVLHQMTYETCKFHEGIFINLMKHFSKFSLHEKV 147 >ref|XP_015900972.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X2 [Ziziphus jujuba] ref|XP_015900973.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X2 [Ziziphus jujuba] ref|XP_015900974.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X2 [Ziziphus jujuba] Length = 520 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -1 Query: 553 AIFLHKLAQYKKYQSLDAVLHQMTYETCKFHEDISICSVGHLHES 419 A L KLA KK+Q++DA+LHQMTYETCKFHEDI + + H +S Sbjct: 100 ATILQKLALSKKFQAIDAILHQMTYETCKFHEDILVNLMKHFSKS 144 >ref|XP_015900970.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X1 [Ziziphus jujuba] Length = 545 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -1 Query: 553 AIFLHKLAQYKKYQSLDAVLHQMTYETCKFHEDISICSVGHLHES 419 A L KLA KK+Q++DA+LHQMTYETCKFHEDI + + H +S Sbjct: 125 ATILQKLALSKKFQAIDAILHQMTYETCKFHEDILVNLMKHFSKS 169 >gb|OMO98439.1| hypothetical protein CCACVL1_04225 [Corchorus capsularis] Length = 515 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -1 Query: 550 IFLHKLAQYKKYQSLDAVLHQMTYETCKFHEDISICSVGH 431 + LH+LAQ KK+Q++D++LHQMTYETCKFHE I I + H Sbjct: 100 VILHRLAQSKKFQAIDSILHQMTYETCKFHEGIFINLMRH 139 >gb|EEF30142.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 521 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = -1 Query: 544 LHKLAQYKKYQSLDAVLHQMTYETCKFHEDISICSVGHLHES 419 +HKLAQ KK+ ++DA+LHQMTYETCKFHE+I + + H ++S Sbjct: 99 IHKLAQTKKFHAVDALLHQMTYETCKFHENIFLNLMKHFYKS 140 >ref|XP_002532248.2| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic [Ricinus communis] Length = 1155 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = -1 Query: 544 LHKLAQYKKYQSLDAVLHQMTYETCKFHEDISICSVGHLHES 419 +HKLAQ KK+ ++DA+LHQMTYETCKFHE+I + + H ++S Sbjct: 733 IHKLAQTKKFHAVDALLHQMTYETCKFHENIFLNLMKHFYKS 774 >ref|XP_021667276.1| pentatricopeptide repeat-containing protein At5g18475 [Hevea brasiliensis] ref|XP_021667277.1| pentatricopeptide repeat-containing protein At5g18475 [Hevea brasiliensis] Length = 513 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -1 Query: 544 LHKLAQYKKYQSLDAVLHQMTYETCKFHEDISICSVGHLHES 419 +HKLAQ KK+Q +DA+LHQMTYETCKFHE+I + + H +S Sbjct: 102 IHKLAQAKKFQVVDALLHQMTYETCKFHENILLNLMKHFSKS 143 >ref|XP_019156414.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475 isoform X2 [Ipomoea nil] Length = 430 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 553 AIFLHKLAQYKKYQSLDAVLHQMTYETCKFHEDI 452 AI LHKLA +++Q +DAVLHQMTYETCKFHED+ Sbjct: 97 AIILHKLAACRRFQMVDAVLHQMTYETCKFHEDL 130