BLASTX nr result
ID: Rehmannia32_contig00011491
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00011491 (654 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN12404.1| hypothetical protein CDL12_14980 [Handroanthus im... 55 2e-06 >gb|PIN12404.1| hypothetical protein CDL12_14980 [Handroanthus impetiginosus] Length = 112 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -2 Query: 101 MKVFGFLCLFLLIGTAAFMYLGYSSKGINSLN 6 MK FGFLCLFLLIGT+AFMYLGYSSK S N Sbjct: 1 MKAFGFLCLFLLIGTSAFMYLGYSSKESTSSN 32