BLASTX nr result
ID: Rehmannia32_contig00011004
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00011004 (810 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN14368.1| hypothetical protein CDL12_12993 [Handroanthus im... 89 2e-17 >gb|PIN14368.1| hypothetical protein CDL12_12993 [Handroanthus impetiginosus] Length = 208 Score = 88.6 bits (218), Expect = 2e-17 Identities = 50/93 (53%), Positives = 59/93 (63%) Frame = -3 Query: 682 RNMLYYAFGIVRRYPCIGRPTDFVKERI*SL*LAKERNHLQRSKAFQSYY*LKCGENAQE 503 R M AFG VR PCIGRP D +K+ + K+ + +K LK GENA+E Sbjct: 6 RIMFILAFGHVRLLPCIGRPIDLLKKESKAYSWPKKEIIFKEAK-LSKLICLKFGENAKE 64 Query: 502 KDKTRFLDVGARTAWKFSDADEPVYCYKALNSV 404 KD R L+VGARTAWKFS ADEP +CYKALNSV Sbjct: 65 KDSMRCLNVGARTAWKFSVADEPEHCYKALNSV 97