BLASTX nr result
ID: Rehmannia32_contig00010956
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00010956 (364 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009344458.1| ribosomal protein S18 (chloroplast) [Rehmann... 128 4e-36 ref|YP_009309473.1| ribosomal protein S18 (chloroplast) [Paulown... 125 4e-35 ref|YP_009254237.1| ribosomal protein S18 (chloroplast) [Erythra... 125 4e-35 ref|YP_009365682.1| ribosomal protein S18 (plastid) [Digitalis l... 124 1e-34 gb|APB96599.1| ribosomal protein S18 (plastid) [Caucalis platyca... 124 2e-34 gb|ATV96863.1| 30S ribosomal protein S18 (chloroplast) [Eschweil... 124 2e-34 gb|AVK80253.1| ribosomal protein S18 (chloroplast) [Pimpinella r... 124 2e-34 ref|YP_009461837.1| ribosomal protein S18 (chloroplast) [Chionan... 124 2e-34 ref|YP_009366535.1| ribosomal protein S18 (plastid) [Mitragyna s... 124 2e-34 gb|ARC99923.1| ribosomal protein S18 (plastid) [Luetkea pectinata] 124 2e-34 ref|YP_009262683.1| 30S ribosomal protein S18 (chloroplast) [Sty... 124 2e-34 ref|YP_009245695.1| ribosomal protein S18 (chloroplast) [Carum c... 124 2e-34 ref|YP_009232851.1| ribosomal protein S18 (chloroplast) [Angelic... 124 2e-34 ref|YP_009232766.1| ribosomal protein S18 (chloroplast) [Angelic... 124 2e-34 ref|YP_003359381.1| ribosomal protein S18 (chloroplast) [Olea eu... 124 2e-34 ref|YP_740139.1| ribosomal protein S18 (chloroplast) [Daucus car... 124 2e-34 ref|YP_358601.1| hypothetical protein PhapfoPp052 [Phalaenopsis ... 123 3e-34 ref|YP_009460797.1| ribosomal protein S18 (plastid) [Galeopsis t... 123 3e-34 ref|YP_009379635.1| ribosomal protein S18 (chloroplast) [Hydrang... 123 3e-34 ref|YP_009459634.1| ribosomal protein S18 (chloroplast) [Scrophu... 123 3e-34 >ref|YP_009344458.1| ribosomal protein S18 (chloroplast) [Rehmannia chingii] ref|YP_009353964.1| ribosomal protein S18 (chloroplast) [Rehmannia glutinosa] ref|YP_009354052.1| ribosomal protein S18 (chloroplast) [Rehmannia henryi] ref|YP_009354139.1| ribosomal protein S18 (chloroplast) [Rehmannia solanifolia] ref|YP_009354227.1| ribosomal protein S18 (chloroplast) [Rehmannia piasezkii] ref|YP_009354314.1| ribosomal protein S18 (chloroplast) [Rehmannia elata] gb|APT42286.1| ribosomal protein S18 (chloroplast) [Rehmannia chingii] gb|AQZ40527.1| ribosomal protein S18 (chloroplast) [Rehmannia glutinosa] gb|AQZ40614.1| ribosomal protein S18 (chloroplast) [Rehmannia henryi] gb|AQZ40702.1| ribosomal protein S18 (chloroplast) [Rehmannia solanifolia] gb|AQZ40789.1| ribosomal protein S18 (chloroplast) [Rehmannia piasezkii] gb|AQZ40876.1| ribosomal protein S18 (chloroplast) [Rehmannia elata] Length = 101 Score = 128 bits (321), Expect = 4e-36 Identities = 67/67 (100%), Positives = 67/67 (100%) Frame = -2 Query: 363 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 184 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM Sbjct: 35 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 94 Query: 183 GLRTRNK 163 GLRTRNK Sbjct: 95 GLRTRNK 101 >ref|YP_009309473.1| ribosomal protein S18 (chloroplast) [Paulownia coreana] ref|YP_009309560.1| ribosomal protein S18 (chloroplast) [Paulownia tomentosa] gb|AKM21534.1| ribosomal protein S18 (chloroplast) [Paulownia coreana] gb|AKM21621.1| ribosomal protein S18 (chloroplast) [Paulownia tomentosa] Length = 101 Score = 125 bits (315), Expect = 4e-35 Identities = 66/67 (98%), Positives = 66/67 (98%) Frame = -2 Query: 363 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 184 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRT Sbjct: 35 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTT 94 Query: 183 GLRTRNK 163 GLRTRNK Sbjct: 95 GLRTRNK 101 >ref|YP_009254237.1| ribosomal protein S18 (chloroplast) [Erythranthe lutea] gb|ANC62937.1| ribosomal protein S18 (chloroplast) [Erythranthe lutea] Length = 103 Score = 125 bits (315), Expect = 4e-35 Identities = 66/67 (98%), Positives = 66/67 (98%) Frame = -2 Query: 363 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 184 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRT Sbjct: 35 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTT 94 Query: 183 GLRTRNK 163 GLRTRNK Sbjct: 95 GLRTRNK 101 >ref|YP_009365682.1| ribosomal protein S18 (plastid) [Digitalis lanata] gb|ARJ61214.1| ribosomal protein S18 (plastid) [Digitalis lanata] Length = 101 Score = 124 bits (311), Expect = 1e-34 Identities = 65/67 (97%), Positives = 66/67 (98%) Frame = -2 Query: 363 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 184 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTEST+RT Sbjct: 35 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTSRTT 94 Query: 183 GLRTRNK 163 GLRTRNK Sbjct: 95 GLRTRNK 101 >gb|APB96599.1| ribosomal protein S18 (plastid) [Caucalis platycarpos] Length = 94 Score = 124 bits (310), Expect = 2e-34 Identities = 65/67 (97%), Positives = 65/67 (97%) Frame = -2 Query: 363 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 184 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRT Sbjct: 28 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTA 87 Query: 183 GLRTRNK 163 GLR RNK Sbjct: 88 GLRARNK 94 >gb|ATV96863.1| 30S ribosomal protein S18 (chloroplast) [Eschweilera congestiflora] Length = 108 Score = 124 bits (311), Expect = 2e-34 Identities = 66/73 (90%), Positives = 66/73 (90%) Frame = -2 Query: 363 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 184 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILS LPFLNNEKQFERTEST RT Sbjct: 35 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSSLPFLNNEKQFERTESTPRTT 94 Query: 183 GLRTRNK*AYSLF 145 GLR RNK YS F Sbjct: 95 GLRNRNKWVYSFF 107 >gb|AVK80253.1| ribosomal protein S18 (chloroplast) [Pimpinella rhomboidea var. tenuiloba] Length = 101 Score = 124 bits (310), Expect = 2e-34 Identities = 65/67 (97%), Positives = 65/67 (97%) Frame = -2 Query: 363 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 184 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRT Sbjct: 35 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTA 94 Query: 183 GLRTRNK 163 GLR RNK Sbjct: 95 GLRARNK 101 >ref|YP_009461837.1| ribosomal protein S18 (chloroplast) [Chionanthus rupicola] ref|YP_009471650.1| ribosomal protein S18 (chloroplast) [Parrotia subaequalis] gb|AUT83986.1| ribosomal protein S18 (chloroplast) [Chionanthus rupicola] gb|AVI15318.1| ribosomal protein S18 (chloroplast) [Parrotia subaequalis] gb|AVI15405.1| ribosomal protein S18 (chloroplast) [Parrotia subaequalis] Length = 101 Score = 124 bits (310), Expect = 2e-34 Identities = 65/67 (97%), Positives = 65/67 (97%) Frame = -2 Query: 363 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 184 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTEST RT Sbjct: 35 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTARTT 94 Query: 183 GLRTRNK 163 GLRTRNK Sbjct: 95 GLRTRNK 101 >ref|YP_009366535.1| ribosomal protein S18 (plastid) [Mitragyna speciosa] gb|ARJ62321.1| ribosomal protein S18 (plastid) [Mitragyna speciosa] Length = 101 Score = 124 bits (310), Expect = 2e-34 Identities = 65/67 (97%), Positives = 65/67 (97%) Frame = -2 Query: 363 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 184 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTEST RT Sbjct: 35 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTARTT 94 Query: 183 GLRTRNK 163 GLRTRNK Sbjct: 95 GLRTRNK 101 >gb|ARC99923.1| ribosomal protein S18 (plastid) [Luetkea pectinata] Length = 101 Score = 124 bits (310), Expect = 2e-34 Identities = 65/67 (97%), Positives = 65/67 (97%) Frame = -2 Query: 363 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 184 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTEST RT Sbjct: 35 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTARTA 94 Query: 183 GLRTRNK 163 GLRTRNK Sbjct: 95 GLRTRNK 101 >ref|YP_009262683.1| 30S ribosomal protein S18 (chloroplast) [Styrax grandiflorus] gb|ANI87348.1| 30S ribosomal protein S18 (chloroplast) [Styrax grandiflorus] gb|ASM46106.1| 30S ribosomal protein S18 (plastid) [Styrax grandiflorus] Length = 101 Score = 124 bits (310), Expect = 2e-34 Identities = 65/67 (97%), Positives = 65/67 (97%) Frame = -2 Query: 363 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 184 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTES TRT Sbjct: 35 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESNTRTT 94 Query: 183 GLRTRNK 163 GLRTRNK Sbjct: 95 GLRTRNK 101 >ref|YP_009245695.1| ribosomal protein S18 (chloroplast) [Carum carvi] gb|AKS28710.1| ribosomal protein S18 (chloroplast) [Carum carvi] Length = 101 Score = 124 bits (310), Expect = 2e-34 Identities = 65/67 (97%), Positives = 65/67 (97%) Frame = -2 Query: 363 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 184 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRT Sbjct: 35 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTA 94 Query: 183 GLRTRNK 163 GLR RNK Sbjct: 95 GLRARNK 101 >ref|YP_009232851.1| ribosomal protein S18 (chloroplast) [Angelica dahurica] ref|YP_009367025.1| ribosomal protein S18 (plastid) [Actaea racemosa] gb|AMA97943.1| ribosomal protein S18 (chloroplast) [Angelica dahurica] Length = 101 Score = 124 bits (310), Expect = 2e-34 Identities = 65/67 (97%), Positives = 65/67 (97%) Frame = -2 Query: 363 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 184 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRT Sbjct: 35 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTA 94 Query: 183 GLRTRNK 163 GLR RNK Sbjct: 95 GLRARNK 101 >ref|YP_009232766.1| ribosomal protein S18 (chloroplast) [Angelica acutiloba] gb|AMA97857.1| ribosomal protein S18 (chloroplast) [Angelica acutiloba] Length = 101 Score = 124 bits (310), Expect = 2e-34 Identities = 65/67 (97%), Positives = 65/67 (97%) Frame = -2 Query: 363 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 184 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRT Sbjct: 35 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTA 94 Query: 183 GLRTRNK 163 GLR RNK Sbjct: 95 GLRARNK 101 >ref|YP_003359381.1| ribosomal protein S18 (chloroplast) [Olea europaea] ref|YP_004376443.1| ribosomal protein S18 [Olea europaea subsp. europaea] ref|YP_004563803.1| ribosomal protein S18 [Olea europaea subsp. cuspidata] ref|YP_004564026.1| ribosomal protein S18 [Olea woodiana subsp. woodiana] ref|YP_004564519.1| ribosomal protein S18 [Olea europaea subsp. maroccana] ref|YP_004935688.1| ribosomal protein S18 (chloroplast) [Sesamum indicum] ref|YP_009110624.1| ribosomal protein S18 (chloroplast) [Hesperelaea palmeri] ref|YP_009309896.1| ribosomal protein S18 (chloroplast) [Abeliophyllum distichum] ref|YP_009383750.1| ribosomal protein S18 (chloroplast) [Chionanthus retusus] ref|YP_009434701.1| 30S ribosomal protein S18 (chloroplast) [Sinowilsonia henryi] ref|YP_009443968.1| ribosomal protein S18 (chloroplast) [Forsythia suspensa] ref|YP_009461749.1| ribosomal protein S18 (chloroplast) [Chionanthus parkinsonii] ref|YP_009461925.1| ribosomal protein S18 (chloroplast) [Forestiera isabelae] ref|YP_009462013.1| ribosomal protein S18 (chloroplast) [Forsythia x intermedia] ref|YP_009462100.1| ribosomal protein S18 (chloroplast) [Nestegis apetala] ref|YP_009462188.1| ribosomal protein S18 (chloroplast) [Noronhia lowryi] ref|YP_009462276.1| ribosomal protein S18 (chloroplast) [Olea exasperata] ref|YP_009462364.1| ribosomal protein S18 (chloroplast) [Schrebera arborea] ref|YP_009468629.1| 30S ribosomal protein S18 (plastid) [Fraxinus chiisanensis] gb|ABG74753.1| ribosomal protein S18 (chloroplast) [Forsythia europaea] gb|ABG74806.1| ribosomal protein S18 (chloroplast) [Jasminum abyssinicum] gb|ADA69948.1| ribosomal protein S18 (chloroplast) [Olea europaea] gb|ADD30001.1| ribosomal protein S18 (chloroplast) [Antirrhinum majus] gb|ADD72111.1| ribosomal protein S18 (chloroplast) [Olea europaea] emb|CBR30337.1| ribosomal protein S18 (plastid) [Olea europaea subsp. europaea] emb|CBR23852.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. cuspidata] emb|CBR24645.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. europaea] emb|CBR30428.1| ribosomal protein S18 (plastid) [Olea europaea subsp. europaea] emb|CBS29374.1| ribosomal protein S18 (chloroplast) [Olea woodiana subsp. woodiana] emb|CBS29264.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. maroccana] emb|CBJ04320.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. cuspidata] emb|CBR23761.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. cuspidata] gb|AEO92728.1| ribosomal protein S18 (chloroplast) [Sesamum indicum] gb|AGL45358.1| ribosomal protein S18 (chloroplast) [Sesamum indicum] emb|CCQ09124.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. europaea] emb|CED79784.1| ribosomal protein S18 (chloroplast) [Hesperelaea palmeri] gb|AKZ24371.1| ribosomal protein S18 (plastid) [Penstemon angustifolius] gb|AKZ24372.1| ribosomal protein S18 (plastid) [Penstemon gracilis] gb|ALZ50039.1| ribosomal protein S18 (chloroplast) [Abeliophyllum distichum] gb|ARS43923.1| ribosomal protein S18 (chloroplast) [Chionanthus retusus] gb|ATG24500.1| 30S ribosomal protein S18 (chloroplast) [Sinowilsonia henryi] gb|ATU07188.1| ribosomal protein S18 (chloroplast) [Forsythia suspensa] gb|AUF33749.1| ribosomal protein S18 (chloroplast) [Fouquieria diguetii] gb|AUT83898.1| ribosomal protein S18 (chloroplast) [Chionanthus parkinsonii] gb|AUT84074.1| ribosomal protein S18 (chloroplast) [Fontanesia phillyreoides subsp. fortunei] gb|AUT84161.1| ribosomal protein S18 (chloroplast) [Forestiera isabelae] gb|AUT84249.1| ribosomal protein S18 (chloroplast) [Forsythia x intermedia] gb|AUT84335.1| ribosomal protein S18 (chloroplast) [Fraxinus ornus] gb|AUT84423.1| ribosomal protein S18 (chloroplast) [Nestegis apetala] gb|AUT84511.1| ribosomal protein S18 (chloroplast) [Noronhia lowryi] gb|AUT84599.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. cuspidata] gb|AUT84686.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. europaea] gb|AUT84775.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. europaea] gb|AUT84863.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. europaea] gb|AUT84951.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. guanchica] gb|AUT85039.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. laperrinei] gb|AUT85126.1| ribosomal protein S18 (chloroplast) [Olea exasperata] gb|AUT85214.1| ribosomal protein S18 (chloroplast) [Schrebera arborea] gb|AVA09417.1| 30S ribosomal protein S18 (plastid) [Fraxinus chiisanensis] gb|AVE14962.1| ribosomal protein S18 (chloroplast) [Forsythia saxatilis] gb|AVM38758.1| ribosomal protein S18 (chloroplast) [Fraxinus excelsior] Length = 101 Score = 124 bits (310), Expect = 2e-34 Identities = 65/67 (97%), Positives = 65/67 (97%) Frame = -2 Query: 363 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 184 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTEST RT Sbjct: 35 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTARTT 94 Query: 183 GLRTRNK 163 GLRTRNK Sbjct: 95 GLRTRNK 101 >ref|YP_740139.1| ribosomal protein S18 (chloroplast) [Daucus carota] ref|YP_009155316.1| ribosomal protein S18 (plastid) [Seseli montanum] ref|YP_009186275.1| ribosomal protein S18 (chloroplast) [Ostericum grosseserratum] ref|YP_009232936.1| ribosomal protein S18 (chloroplast) [Angelica gigas] ref|YP_009233021.1| ribosomal protein S18 (chloroplast) [Ligusticum tenuissimum] ref|YP_009235901.1| ribosomal protein S18 (chloroplast) [Foeniculum vulgare] ref|YP_009235986.1| ribosomal protein S18 (chloroplast) [Anethum graveolens] ref|YP_009243588.1| ribosomal protein S18 (chloroplast) [Coriandrum sativum] ref|YP_009331719.1| ribosomal protein S18 (chloroplast) [Arracacia xanthorrhiza] ref|YP_009338363.1| ribosomal protein S18 (chloroplast) [Peucedanum insolens] ref|YP_009363699.1| ribosomal protein S18 (chloroplast) [Glehnia littoralis] sp|Q0G9U0.1|RR18_DAUCA RecName: Full=30S ribosomal protein S18, chloroplastic gb|ABI32446.1| ribosomal protein S18 (chloroplast) [Daucus carota] gb|ABU85200.1| ribosomal protein S18, partial (chloroplast) [Anethum graveolens] gb|ADK89800.1| ribosomal protein S18 (chloroplast) [Tiedemannia filiformis subsp. greenmannii] gb|AIU99124.1| ribosomal protein S18 (plastid) [Seseli montanum] gb|AKS03638.1| ribosomal protein S18 (chloroplast) [Coriandrum sativum] gb|AKZ24384.1| ribosomal protein S18 (plastid) [Zizia aurea] gb|ALN96870.1| ribosomal protein S18 (chloroplast) [Angelica decursiva] gb|ALO71647.1| ribosomal protein S18 (chloroplast) [Ostericum grosseserratum] gb|AMA98028.1| ribosomal protein S18 (chloroplast) [Angelica gigas] gb|AMA98114.1| ribosomal protein S18 (chloroplast) [Ligusticum tenuissimum] gb|AMD83937.1| ribosomal protein S18 (chloroplast) [Foeniculum vulgare] gb|AMD84022.1| ribosomal protein S18 (chloroplast) [Anethum graveolens] gb|KZM81244.1| ribosomal protein S18 (plastid) [Daucus carota subsp. sativus] gb|ANK36458.1| ribosomal protein S18 (chloroplast) [Peucedanum insolens] gb|ANS72052.1| ribosomal protein S18 (chloroplast) [Glehnia littoralis] gb|AOT84686.1| ribosomal protein S18 (chloroplast) [Glehnia littoralis] gb|APB93625.1| ribosomal protein S18 (plastid) [Daucus carota subsp. carota] gb|APB93710.1| ribosomal protein S18 (plastid) [Daucus carota subsp. carota] gb|APB93795.1| ribosomal protein S18 (plastid) [Daucus carota subsp. gummifer] gb|APB93880.1| ribosomal protein S18 (plastid) [Daucus carota subsp. capillifolius] gb|APB93965.1| ribosomal protein S18 (plastid) [Daucus carota subsp. maximus] gb|APB94135.1| ribosomal protein S18 (plastid) [Daucus carota subsp. gummifer] gb|APB94220.1| ribosomal protein S18 (plastid) [Daucus carota subsp. gummifer] gb|APB94305.1| ribosomal protein S18 (plastid) [Daucus carota subsp. carota] gb|APB94390.1| ribosomal protein S18 (plastid) [Daucus carota subsp. maximus] gb|APB94475.1| ribosomal protein S18 (plastid) [Daucus syrticus] gb|APB94560.1| ribosomal protein S18 (plastid) [Daucus syrticus] gb|APB94645.1| ribosomal protein S18 (plastid) [Daucus rouyi] gb|APB94730.1| ribosomal protein S18 (plastid) [Daucus pumilus] gb|APB94815.1| ribosomal protein S18 (plastid) [Daucus aureus] gb|APB94900.1| ribosomal protein S18 (plastid) [Daucus muricatus] gb|APB94985.1| ribosomal protein S18 (plastid) [Daucus muricatus] gb|APB95070.1| ribosomal protein S18 (plastid) [Daucus crinitus] gb|APB95155.1| ribosomal protein S18 (plastid) [Daucus crinitus] gb|APB95240.1| ribosomal protein S18 (plastid) [Daucus tenuisectus] gb|APB95325.1| ribosomal protein S18 (plastid) [Daucus guttatus] gb|APB95410.1| ribosomal protein S18 (plastid) [Daucus guttatus] gb|APB95495.1| ribosomal protein S18 (plastid) [Daucus littoralis] gb|APB95580.1| ribosomal protein S18 (plastid) [Daucus glochidiatus] gb|APB95665.1| ribosomal protein S18 (plastid) [Daucus guttatus] gb|APB95750.1| ribosomal protein S18 (plastid) [Daucus guttatus] gb|APB95835.1| ribosomal protein S18 (plastid) [Daucus setulosus] gb|APB95920.1| ribosomal protein S18 (plastid) [Daucus setulosus] gb|APB96175.1| ribosomal protein S18 (plastid) [Daucus conchitae] gb|APB96260.1| ribosomal protein S18 (plastid) [Daucus conchitae] gb|APB96344.1| ribosomal protein S18 (plastid) [Daucus conchitae] gb|APB96429.1| ribosomal protein S18 (plastid) [Daucus involucratus] gb|APB96514.1| ribosomal protein S18 (plastid) [Daucus involucratus] gb|APB96684.1| ribosomal protein S18 (plastid) [Oenanthe virgata] gb|APH07287.1| ribosomal protein S18 (chloroplast) [Arracacia xanthorrhiza] gb|ATL63037.1| ribosomal protein S18 (chloroplast) [Angelica nitida] Length = 101 Score = 124 bits (310), Expect = 2e-34 Identities = 65/67 (97%), Positives = 65/67 (97%) Frame = -2 Query: 363 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 184 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRT Sbjct: 35 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTA 94 Query: 183 GLRTRNK 163 GLR RNK Sbjct: 95 GLRARNK 101 >ref|YP_358601.1| hypothetical protein PhapfoPp052 [Phalaenopsis aphrodite subsp. formosana] gb|AAW82559.1| hypothetical protein (chloroplast) [Phalaenopsis aphrodite subsp. formosana] Length = 85 Score = 123 bits (308), Expect = 3e-34 Identities = 60/72 (83%), Positives = 63/72 (87%) Frame = +2 Query: 149 KE*AYLFLVLRPIVLVVDSVLSNCFSLLRKGNNDKIRACFIAIVINRCCFKVNLFTRLDN 328 +E YLFLVL P+VL +DS LSNCFSLLRKGN DKIRACFIAIVINRCCFKVNLF RLD Sbjct: 10 EEYIYLFLVLGPVVLGIDSTLSNCFSLLRKGNKDKIRACFIAIVINRCCFKVNLFVRLDK 69 Query: 329 IFPCSLINRLIK 364 IFPCSL NRLIK Sbjct: 70 IFPCSLRNRLIK 81 >ref|YP_009460797.1| ribosomal protein S18 (plastid) [Galeopsis tetrahit] gb|AUT82098.1| ribosomal protein S18 (plastid) [Galeopsis tetrahit] Length = 101 Score = 123 bits (309), Expect = 3e-34 Identities = 65/67 (97%), Positives = 65/67 (97%) Frame = -2 Query: 363 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 184 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFER ESTTRT Sbjct: 35 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERIESTTRTA 94 Query: 183 GLRTRNK 163 GLRTRNK Sbjct: 95 GLRTRNK 101 >ref|YP_009379635.1| ribosomal protein S18 (chloroplast) [Hydrangea hydrangeoides] gb|ARQ81868.1| ribosomal protein S18 (chloroplast) [Hydrangea hydrangeoides] Length = 101 Score = 123 bits (309), Expect = 3e-34 Identities = 65/67 (97%), Positives = 65/67 (97%) Frame = -2 Query: 363 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 184 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILS LPFLNNEKQFERTESTTRT Sbjct: 35 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSSLPFLNNEKQFERTESTTRTT 94 Query: 183 GLRTRNK 163 GLRTRNK Sbjct: 95 GLRTRNK 101 >ref|YP_009459634.1| ribosomal protein S18 (chloroplast) [Scrophularia dentata] gb|ALJ01923.1| ribosomal protein S18 (chloroplast) [Scrophularia dentata] gb|AUT13280.1| ribosomal protein S18 (chloroplast) [Scrophularia dentata] Length = 101 Score = 123 bits (309), Expect = 3e-34 Identities = 65/67 (97%), Positives = 65/67 (97%) Frame = -2 Query: 363 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTM 184 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRT Sbjct: 35 LISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFERTESTTRTT 94 Query: 183 GLRTRNK 163 GLRTR K Sbjct: 95 GLRTRTK 101