BLASTX nr result
ID: Rehmannia32_contig00009142
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00009142 (403 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088833.1| pentatricopeptide repeat-containing protein ... 114 5e-27 gb|KZV31636.1| pentatricopeptide repeat-containing protein [Dorc... 113 2e-26 ref|XP_012847095.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 107 2e-24 emb|CDP20360.1| unnamed protein product [Coffea canephora] 95 5e-20 ref|XP_019263317.1| PREDICTED: pentatricopeptide repeat-containi... 87 4e-17 ref|XP_016496663.1| PREDICTED: pentatricopeptide repeat-containi... 87 4e-17 ref|XP_009604488.1| PREDICTED: pentatricopeptide repeat-containi... 87 4e-17 ref|XP_015085097.1| PREDICTED: pentatricopeptide repeat-containi... 87 4e-17 ref|XP_018627323.1| PREDICTED: pentatricopeptide repeat-containi... 87 4e-17 ref|XP_010325168.1| PREDICTED: pentatricopeptide repeat-containi... 87 4e-17 ref|XP_006356647.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-16 ref|XP_019263319.1| PREDICTED: pentatricopeptide repeat-containi... 84 4e-16 ref|XP_016496664.1| PREDICTED: pentatricopeptide repeat-containi... 84 4e-16 ref|XP_015085098.1| PREDICTED: pentatricopeptide repeat-containi... 84 4e-16 ref|XP_009604489.1| PREDICTED: pentatricopeptide repeat-containi... 84 4e-16 ref|XP_004245260.1| PREDICTED: pentatricopeptide repeat-containi... 84 4e-16 ref|XP_016449168.1| PREDICTED: pentatricopeptide repeat-containi... 84 4e-16 ref|XP_009785708.1| PREDICTED: pentatricopeptide repeat-containi... 84 4e-16 ref|XP_017230210.1| PREDICTED: pentatricopeptide repeat-containi... 82 2e-15 ref|XP_016449169.1| PREDICTED: pentatricopeptide repeat-containi... 81 3e-15 >ref|XP_011088833.1| pentatricopeptide repeat-containing protein At5g25630 [Sesamum indicum] ref|XP_020549790.1| pentatricopeptide repeat-containing protein At5g25630 [Sesamum indicum] Length = 625 Score = 114 bits (286), Expect = 5e-27 Identities = 58/92 (63%), Positives = 71/92 (77%) Frame = +2 Query: 128 MGYQEEFHKEMSNLEINSKNDSNLVLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFCT 307 MGY EEF K+ SN +I SK+ ++ ++ +ER +E S EKIQ YP+PESTLCTFC Sbjct: 1 MGYLEEFDKDSSNSKIKSKSQASTLVLNER------QETSHGEKIQVYPIPESTLCTFCM 54 Query: 308 SEESCKIVRSRTKLMNILLERGKPSEAQSVFN 403 + ESCKIVRSRTKLMN+LLE+GKP EAQSVFN Sbjct: 55 NGESCKIVRSRTKLMNVLLEKGKPQEAQSVFN 86 >gb|KZV31636.1| pentatricopeptide repeat-containing protein [Dorcoceras hygrometricum] Length = 607 Score = 113 bits (282), Expect = 2e-26 Identities = 55/93 (59%), Positives = 71/93 (76%), Gaps = 1/93 (1%) Frame = +2 Query: 128 MGYQEEFHKEMSNLEINSKNDSN-LVLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFC 304 MGY +F KE + ++ + N L+L+ + +E S KE++ DEKIQ YPMPESTLCTFC Sbjct: 1 MGYLGDFDKESGDSDMTITSPGNTLILKGKWVEEFSNKERAHDEKIQLYPMPESTLCTFC 60 Query: 305 TSEESCKIVRSRTKLMNILLERGKPSEAQSVFN 403 S ESCK+VRS+TK+MNILLE+GKP +AQSVFN Sbjct: 61 MSGESCKVVRSQTKMMNILLEKGKPQDAQSVFN 93 >ref|XP_012847095.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g25630 [Erythranthe guttata] Length = 571 Score = 107 bits (267), Expect = 2e-24 Identities = 58/92 (63%), Positives = 65/92 (70%) Frame = +2 Query: 128 MGYQEEFHKEMSNLEINSKNDSNLVLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFCT 307 MGY EEF KE +N EIN KN Q+ I ++S DEKI F P ES LCTFCT Sbjct: 1 MGYLEEFDKESANSEINCKN-----------QDDPIMKRSPDEKINFNPPSESPLCTFCT 49 Query: 308 SEESCKIVRSRTKLMNILLERGKPSEAQSVFN 403 S+ESCKIVRSRTKLMNIL+E+GK EAQSVFN Sbjct: 50 SDESCKIVRSRTKLMNILVEKGKHQEAQSVFN 81 >emb|CDP20360.1| unnamed protein product [Coffea canephora] Length = 629 Score = 95.1 bits (235), Expect = 5e-20 Identities = 48/88 (54%), Positives = 63/88 (71%), Gaps = 1/88 (1%) Frame = +2 Query: 143 EFHKEMSNLEINSKNDS-NLVLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFCTSEES 319 EF +E ++ + + + V++ E AQ+ I+EKS D IQ +P+PESTLCTFC S Sbjct: 3 EFFEERTHSDTMKETQGCSKVIKKELAQQAPIEEKSIDNMIQLHPIPESTLCTFCMSGNI 62 Query: 320 CKIVRSRTKLMNILLERGKPSEAQSVFN 403 C+ V+SRTKLMNILLERGKP EAQS+FN Sbjct: 63 CRTVQSRTKLMNILLERGKPQEAQSIFN 90 >ref|XP_019263317.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X1 [Nicotiana attenuata] gb|OIT37243.1| pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 640 Score = 86.7 bits (213), Expect = 4e-17 Identities = 43/91 (47%), Positives = 57/91 (62%), Gaps = 1/91 (1%) Frame = +2 Query: 134 YQEEFHKEMSNLEI-NSKNDSNLVLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFCTS 310 Y ++F KE N E K+ ++R E IKEK D+K+ P PES LCTFC + Sbjct: 11 YMDDFGKERQNCETYRKKSGMRTLIRKEWLHASPIKEKDPDDKMPLRPTPESGLCTFCVN 70 Query: 311 EESCKIVRSRTKLMNILLERGKPSEAQSVFN 403 SC+ VRSRTKLMN +LERG+P EA+ +F+ Sbjct: 71 GNSCRTVRSRTKLMNTVLERGRPKEAELIFD 101 >ref|XP_016496663.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like isoform X1 [Nicotiana tabacum] Length = 640 Score = 86.7 bits (213), Expect = 4e-17 Identities = 43/91 (47%), Positives = 58/91 (63%), Gaps = 1/91 (1%) Frame = +2 Query: 134 YQEEFHKEMSNLEI-NSKNDSNLVLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFCTS 310 Y ++F KE N E + K+ ++R E IKEK D+K+ P PES LCTFC + Sbjct: 11 YMDDFGKEKRNCETYHKKSGMRTLIRKEWLHASPIKEKDLDDKMPLRPTPESVLCTFCVN 70 Query: 311 EESCKIVRSRTKLMNILLERGKPSEAQSVFN 403 SC+ VRSRTKLMN +LERG+P EA+ +F+ Sbjct: 71 GNSCRTVRSRTKLMNTVLERGRPKEAELIFD 101 >ref|XP_009604488.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X2 [Nicotiana tomentosiformis] Length = 640 Score = 86.7 bits (213), Expect = 4e-17 Identities = 43/91 (47%), Positives = 58/91 (63%), Gaps = 1/91 (1%) Frame = +2 Query: 134 YQEEFHKEMSNLEI-NSKNDSNLVLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFCTS 310 Y ++F KE N E + K+ ++R E IKEK D+K+ P PES LCTFC + Sbjct: 11 YMDDFGKEKRNCETYHKKSGMRTLIRKEWLHTSPIKEKDLDDKMPLRPTPESVLCTFCVN 70 Query: 311 EESCKIVRSRTKLMNILLERGKPSEAQSVFN 403 SC+ VRSRTKLMN +LERG+P EA+ +F+ Sbjct: 71 GNSCRTVRSRTKLMNTVLERGRPKEAELIFD 101 >ref|XP_015085097.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like isoform X1 [Solanum pennellii] Length = 647 Score = 86.7 bits (213), Expect = 4e-17 Identities = 44/92 (47%), Positives = 61/92 (66%), Gaps = 2/92 (2%) Frame = +2 Query: 134 YQEEFHKEMSNLEINSKNDSNL--VLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFCT 307 Y ++F KE SN E NS+ S + ++R E SIKEK ++K+ P PES+LC FC Sbjct: 18 YMDDFRKERSNCE-NSRRKSGMKTLIRKEFLHPFSIKEKDLEDKMPLRPTPESSLCAFCV 76 Query: 308 SEESCKIVRSRTKLMNILLERGKPSEAQSVFN 403 + SC+ VR+RTKLMN +LERG+P EA+ F+ Sbjct: 77 NGNSCRTVRARTKLMNTVLERGRPEEARLTFD 108 >ref|XP_018627323.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X1 [Nicotiana tomentosiformis] Length = 650 Score = 86.7 bits (213), Expect = 4e-17 Identities = 43/91 (47%), Positives = 58/91 (63%), Gaps = 1/91 (1%) Frame = +2 Query: 134 YQEEFHKEMSNLEI-NSKNDSNLVLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFCTS 310 Y ++F KE N E + K+ ++R E IKEK D+K+ P PES LCTFC + Sbjct: 21 YMDDFGKEKRNCETYHKKSGMRTLIRKEWLHTSPIKEKDLDDKMPLRPTPESVLCTFCVN 80 Query: 311 EESCKIVRSRTKLMNILLERGKPSEAQSVFN 403 SC+ VRSRTKLMN +LERG+P EA+ +F+ Sbjct: 81 GNSCRTVRSRTKLMNTVLERGRPKEAELIFD 111 >ref|XP_010325168.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X1 [Solanum lycopersicum] Length = 675 Score = 86.7 bits (213), Expect = 4e-17 Identities = 44/92 (47%), Positives = 61/92 (66%), Gaps = 2/92 (2%) Frame = +2 Query: 134 YQEEFHKEMSNLEINSKNDSNL--VLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFCT 307 Y ++F KE SN E NS+ S + ++R E SIKEK ++K+ P PES+LC FC Sbjct: 46 YMDDFRKERSNCE-NSRRKSGMKTLIRKEFLHPFSIKEKDLEDKMPLRPTPESSLCAFCV 104 Query: 308 SEESCKIVRSRTKLMNILLERGKPSEAQSVFN 403 + SC+ VR+RTKLMN +LERG+P EA+ F+ Sbjct: 105 NGNSCRTVRARTKLMNTVLERGRPEEARLTFD 136 >ref|XP_006356647.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like [Solanum tuberosum] ref|XP_006356648.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like [Solanum tuberosum] Length = 629 Score = 84.7 bits (208), Expect = 2e-16 Identities = 42/89 (47%), Positives = 58/89 (65%), Gaps = 1/89 (1%) Frame = +2 Query: 140 EEFHKEMSNLEINS-KNDSNLVLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFCTSEE 316 ++F KE SN E + K+ ++R E SIKEK D+K+ P PES+LC FC + Sbjct: 2 DDFRKERSNCEKSRRKSGMKTLIRKELLHPFSIKEKDLDDKMPLQPTPESSLCAFCVNGN 61 Query: 317 SCKIVRSRTKLMNILLERGKPSEAQSVFN 403 SC+ VR+RTKLMN +LERG+P EA+ F+ Sbjct: 62 SCRTVRARTKLMNTVLERGRPEEARLTFD 90 >ref|XP_019263319.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X2 [Nicotiana attenuata] Length = 629 Score = 84.0 bits (206), Expect = 4e-16 Identities = 42/89 (47%), Positives = 56/89 (62%), Gaps = 1/89 (1%) Frame = +2 Query: 140 EEFHKEMSNLEI-NSKNDSNLVLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFCTSEE 316 ++F KE N E K+ ++R E IKEK D+K+ P PES LCTFC + Sbjct: 2 DDFGKERQNCETYRKKSGMRTLIRKEWLHASPIKEKDPDDKMPLRPTPESGLCTFCVNGN 61 Query: 317 SCKIVRSRTKLMNILLERGKPSEAQSVFN 403 SC+ VRSRTKLMN +LERG+P EA+ +F+ Sbjct: 62 SCRTVRSRTKLMNTVLERGRPKEAELIFD 90 >ref|XP_016496664.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like isoform X2 [Nicotiana tabacum] Length = 629 Score = 84.0 bits (206), Expect = 4e-16 Identities = 42/89 (47%), Positives = 57/89 (64%), Gaps = 1/89 (1%) Frame = +2 Query: 140 EEFHKEMSNLEI-NSKNDSNLVLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFCTSEE 316 ++F KE N E + K+ ++R E IKEK D+K+ P PES LCTFC + Sbjct: 2 DDFGKEKRNCETYHKKSGMRTLIRKEWLHASPIKEKDLDDKMPLRPTPESVLCTFCVNGN 61 Query: 317 SCKIVRSRTKLMNILLERGKPSEAQSVFN 403 SC+ VRSRTKLMN +LERG+P EA+ +F+ Sbjct: 62 SCRTVRSRTKLMNTVLERGRPKEAELIFD 90 >ref|XP_015085098.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like isoform X2 [Solanum pennellii] Length = 629 Score = 84.0 bits (206), Expect = 4e-16 Identities = 43/90 (47%), Positives = 60/90 (66%), Gaps = 2/90 (2%) Frame = +2 Query: 140 EEFHKEMSNLEINSKNDSNL--VLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFCTSE 313 ++F KE SN E NS+ S + ++R E SIKEK ++K+ P PES+LC FC + Sbjct: 2 DDFRKERSNCE-NSRRKSGMKTLIRKEFLHPFSIKEKDLEDKMPLRPTPESSLCAFCVNG 60 Query: 314 ESCKIVRSRTKLMNILLERGKPSEAQSVFN 403 SC+ VR+RTKLMN +LERG+P EA+ F+ Sbjct: 61 NSCRTVRARTKLMNTVLERGRPEEARLTFD 90 >ref|XP_009604489.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X3 [Nicotiana tomentosiformis] Length = 629 Score = 84.0 bits (206), Expect = 4e-16 Identities = 42/89 (47%), Positives = 57/89 (64%), Gaps = 1/89 (1%) Frame = +2 Query: 140 EEFHKEMSNLEI-NSKNDSNLVLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFCTSEE 316 ++F KE N E + K+ ++R E IKEK D+K+ P PES LCTFC + Sbjct: 2 DDFGKEKRNCETYHKKSGMRTLIRKEWLHTSPIKEKDLDDKMPLRPTPESVLCTFCVNGN 61 Query: 317 SCKIVRSRTKLMNILLERGKPSEAQSVFN 403 SC+ VRSRTKLMN +LERG+P EA+ +F+ Sbjct: 62 SCRTVRSRTKLMNTVLERGRPKEAELIFD 90 >ref|XP_004245260.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X2 [Solanum lycopersicum] Length = 629 Score = 84.0 bits (206), Expect = 4e-16 Identities = 43/90 (47%), Positives = 60/90 (66%), Gaps = 2/90 (2%) Frame = +2 Query: 140 EEFHKEMSNLEINSKNDSNL--VLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFCTSE 313 ++F KE SN E NS+ S + ++R E SIKEK ++K+ P PES+LC FC + Sbjct: 2 DDFRKERSNCE-NSRRKSGMKTLIRKEFLHPFSIKEKDLEDKMPLRPTPESSLCAFCVNG 60 Query: 314 ESCKIVRSRTKLMNILLERGKPSEAQSVFN 403 SC+ VR+RTKLMN +LERG+P EA+ F+ Sbjct: 61 NSCRTVRARTKLMNTVLERGRPEEARLTFD 90 >ref|XP_016449168.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like isoform X1 [Nicotiana tabacum] Length = 643 Score = 84.0 bits (206), Expect = 4e-16 Identities = 42/91 (46%), Positives = 56/91 (61%), Gaps = 1/91 (1%) Frame = +2 Query: 134 YQEEFHKEMSNLEI-NSKNDSNLVLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFCTS 310 Y ++F KE N E K+ ++R E IKEK D+K+ P PES CTFC + Sbjct: 14 YMDDFGKERQNCETYRKKSGMRTLIRKEWLHASPIKEKDPDDKMPLRPTPESGHCTFCVN 73 Query: 311 EESCKIVRSRTKLMNILLERGKPSEAQSVFN 403 SC+ VRSRTKLMN +LERG+P EA+ +F+ Sbjct: 74 GNSCRTVRSRTKLMNTVLERGRPKEAELIFD 104 >ref|XP_009785708.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X1 [Nicotiana sylvestris] Length = 643 Score = 84.0 bits (206), Expect = 4e-16 Identities = 42/91 (46%), Positives = 56/91 (61%), Gaps = 1/91 (1%) Frame = +2 Query: 134 YQEEFHKEMSNLEI-NSKNDSNLVLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFCTS 310 Y ++F KE N E K+ ++R E IKEK D+K+ P PES CTFC + Sbjct: 14 YMDDFGKERQNCETYRKKSGMRTLIRKEWLHASPIKEKDPDDKMPLRPTPESGHCTFCVN 73 Query: 311 EESCKIVRSRTKLMNILLERGKPSEAQSVFN 403 SC+ VRSRTKLMN +LERG+P EA+ +F+ Sbjct: 74 GNSCRTVRSRTKLMNTVLERGRPKEAELIFD 104 >ref|XP_017230210.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like [Daucus carota subsp. sativus] ref|XP_017230211.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like [Daucus carota subsp. sativus] gb|KZN11841.1| hypothetical protein DCAR_004497 [Daucus carota subsp. sativus] Length = 628 Score = 82.0 bits (201), Expect = 2e-15 Identities = 42/70 (60%), Positives = 49/70 (70%) Frame = +2 Query: 194 NLVLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFCTSEESCKIVRSRTKLMNILLERG 373 N V R+E Q IK K+ D IQF P PES LCTFC + SC+ VRS+TKLMNIL ERG Sbjct: 21 NAVNRNELIQLSPIKRKNQDGWIQFSPHPESILCTFCLGKVSCRTVRSKTKLMNILTERG 80 Query: 374 KPSEAQSVFN 403 KP EA S+F+ Sbjct: 81 KPEEALSIFD 90 >ref|XP_016449169.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like isoform X2 [Nicotiana tabacum] ref|XP_016449170.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like isoform X2 [Nicotiana tabacum] ref|XP_016449171.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like isoform X2 [Nicotiana tabacum] ref|XP_016449172.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like isoform X2 [Nicotiana tabacum] Length = 629 Score = 81.3 bits (199), Expect = 3e-15 Identities = 41/89 (46%), Positives = 55/89 (61%), Gaps = 1/89 (1%) Frame = +2 Query: 140 EEFHKEMSNLEI-NSKNDSNLVLRDERAQELSIKEKSGDEKIQFYPMPESTLCTFCTSEE 316 ++F KE N E K+ ++R E IKEK D+K+ P PES CTFC + Sbjct: 2 DDFGKERQNCETYRKKSGMRTLIRKEWLHASPIKEKDPDDKMPLRPTPESGHCTFCVNGN 61 Query: 317 SCKIVRSRTKLMNILLERGKPSEAQSVFN 403 SC+ VRSRTKLMN +LERG+P EA+ +F+ Sbjct: 62 SCRTVRSRTKLMNTVLERGRPKEAELIFD 90