BLASTX nr result
ID: Rehmannia32_contig00009098
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00009098 (660 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlise... 81 1e-16 gb|KQK20681.1| hypothetical protein BRADI_1g63372v3 [Brachypodiu... 71 7e-13 gb|PHT54995.1| ATP synthase subunit alpha, chloroplastic [Capsic... 67 1e-09 gb|OAY33821.1| hypothetical protein MANES_13G128000 [Manihot esc... 61 5e-09 >gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlisea aurea] Length = 72 Score = 81.3 bits (199), Expect = 1e-16 Identities = 38/43 (88%), Positives = 40/43 (93%), Gaps = 3/43 (6%) Frame = +3 Query: 3 AGIEPASLAWKARGYSRRRFS---VSNSKPNMKLWFHSAPLWK 122 AGIEPASLAWKA+GYSRRRFS VSNSKPNMKLWFHSAPLW+ Sbjct: 15 AGIEPASLAWKAKGYSRRRFSSLSVSNSKPNMKLWFHSAPLWR 57 >gb|KQK20681.1| hypothetical protein BRADI_1g63372v3 [Brachypodium distachyon] Length = 59 Score = 70.9 bits (172), Expect = 7e-13 Identities = 40/64 (62%), Positives = 42/64 (65%), Gaps = 3/64 (4%) Frame = +3 Query: 3 AGIEPASLAWKARGYSRR---RFSVSNSKPNMKLWFHSAPLWKMSKFLDLRCEQNYTHNT 173 AGIEPASLAWKARGYSRR ++VSNSKPNMK FHSAPLW S N Sbjct: 5 AGIEPASLAWKARGYSRRWLIIYNVSNSKPNMKFSFHSAPLWIFSPL-----------NI 53 Query: 174 YVSF 185 YVSF Sbjct: 54 YVSF 57 >gb|PHT54995.1| ATP synthase subunit alpha, chloroplastic [Capsicum baccatum] Length = 275 Score = 67.0 bits (162), Expect = 1e-09 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 3/53 (5%) Frame = +3 Query: 243 ILTIFLVTSF---SISI*EDPKEKDFVSTELKQYADVSSKPKSSLNSYFASIS 392 I+TI+ T+ S+ + +DP+EK+FVSTELKQY DVSSKPKSS NSYFAS+S Sbjct: 217 IMTIYTRTNSYLDSLEVGQDPEEKEFVSTELKQYVDVSSKPKSSFNSYFASLS 269 >gb|OAY33821.1| hypothetical protein MANES_13G128000 [Manihot esculenta] Length = 72 Score = 61.2 bits (147), Expect = 5e-09 Identities = 38/74 (51%), Positives = 45/74 (60%) Frame = +2 Query: 221 MILLEEGDSNNLSSYFVLYFYLRGS*GKGFCFHRAKTICRCL**TKVIVE*LFCFNFFL* 400 MI L+E D NN SSYFVLY YLR S GK FCFHRAK TK F + Sbjct: 1 MIPLDEWDFNNFSSYFVLYSYLRESLGKAFCFHRAK--------TKSAFNAYFA-SISTI 51 Query: 401 KSNKKMEDLVTIRN 442 ++ +++EDLVTIRN Sbjct: 52 QNKEQIEDLVTIRN 65