BLASTX nr result
ID: Rehmannia32_contig00009040
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00009040 (696 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085764.1| thioredoxin-like protein CITRX1, chloroplast... 83 5e-16 gb|OMO87364.1| Thioredoxin [Corchorus olitorius] 80 6e-16 ref|XP_010067721.1| PREDICTED: thioredoxin-like protein CITRX2, ... 83 7e-16 ref|XP_022864456.1| thioredoxin-like protein CITRX2, chloroplast... 82 1e-15 ref|XP_012836436.1| PREDICTED: thioredoxin-like protein CITRX2, ... 82 1e-15 ref|XP_021862427.1| thioredoxin-like protein CITRX, chloroplasti... 82 2e-15 gb|KNA14657.1| hypothetical protein SOVF_105460 [Spinacia oleracea] 82 2e-15 gb|PIN01594.1| Thioredoxin [Handroanthus impetiginosus] 81 2e-15 gb|OWM90045.1| hypothetical protein CDL15_Pgr026958 [Punica gran... 81 4e-15 gb|PON98762.1| Thioredoxin [Trema orientalis] 80 4e-15 gb|EYU38291.1| hypothetical protein MIMGU_mgv1a012971mg [Erythra... 82 4e-15 ref|XP_006432437.1| thioredoxin-like protein CITRX, chloroplasti... 80 4e-15 gb|EYU38290.1| hypothetical protein MIMGU_mgv1a012971mg [Erythra... 82 5e-15 ref|XP_013644008.1| thioredoxin-like protein CITRX, chloroplasti... 77 5e-15 ref|XP_021752903.1| thioredoxin-like protein CITRX, chloroplasti... 80 6e-15 ref|XP_012457198.1| PREDICTED: thioredoxin-like protein CITRX, c... 80 7e-15 ref|XP_017647132.1| PREDICTED: thioredoxin-like protein CITRX, c... 80 7e-15 ref|XP_021299948.1| thioredoxin-like protein CITRX, chloroplasti... 80 7e-15 ref|XP_007010928.1| PREDICTED: thioredoxin-like protein CITRX, c... 80 7e-15 gb|PHU09808.1| Thioredoxin-like protein CITRX, chloroplastic [Ca... 80 7e-15 >ref|XP_011085764.1| thioredoxin-like protein CITRX1, chloroplastic [Sesamum indicum] Length = 176 Score = 82.8 bits (203), Expect = 5e-16 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDIL+NEM Sbjct: 137 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILDNEM 176 >gb|OMO87364.1| Thioredoxin [Corchorus olitorius] Length = 76 Score = 79.7 bits (195), Expect = 6e-16 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 MQVRGLPTL+FISPDPNK+AIRTEGLIPIQMMRDIL+NEM Sbjct: 37 MQVRGLPTLFFISPDPNKEAIRTEGLIPIQMMRDILDNEM 76 >ref|XP_010067721.1| PREDICTED: thioredoxin-like protein CITRX2, chloroplastic [Eucalyptus grandis] gb|KCW65901.1| hypothetical protein EUGRSUZ_G03224 [Eucalyptus grandis] Length = 186 Score = 82.8 bits (203), Expect = 7e-16 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDIL+NEM Sbjct: 147 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILDNEM 186 >ref|XP_022864456.1| thioredoxin-like protein CITRX2, chloroplastic [Olea europaea var. sylvestris] Length = 179 Score = 82.0 bits (201), Expect = 1e-15 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDI++NEM Sbjct: 140 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDIIDNEM 179 >ref|XP_012836436.1| PREDICTED: thioredoxin-like protein CITRX2, chloroplastic [Erythranthe guttata] Length = 176 Score = 81.6 bits (200), Expect = 1e-15 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDIL+N+M Sbjct: 137 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILDNDM 176 >ref|XP_021862427.1| thioredoxin-like protein CITRX, chloroplastic [Spinacia oleracea] Length = 181 Score = 81.6 bits (200), Expect = 2e-15 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDIL+N+M Sbjct: 142 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILDNDM 181 >gb|KNA14657.1| hypothetical protein SOVF_105460 [Spinacia oleracea] Length = 181 Score = 81.6 bits (200), Expect = 2e-15 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDIL+N+M Sbjct: 142 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILDNDM 181 >gb|PIN01594.1| Thioredoxin [Handroanthus impetiginosus] Length = 176 Score = 81.3 bits (199), Expect = 2e-15 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMR+IL+NEM Sbjct: 137 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMREILDNEM 176 >gb|OWM90045.1| hypothetical protein CDL15_Pgr026958 [Punica granatum] gb|PKI66557.1| hypothetical protein CRG98_013041 [Punica granatum] Length = 204 Score = 81.3 bits (199), Expect = 4e-15 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 MQVRGLPTLYFISPDPNK+AIRTEGLIPIQMMRDIL+NEM Sbjct: 165 MQVRGLPTLYFISPDPNKEAIRTEGLIPIQMMRDILDNEM 204 >gb|PON98762.1| Thioredoxin [Trema orientalis] Length = 181 Score = 80.5 bits (197), Expect = 4e-15 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 MQVRGLPTL+FISPDPNKDAIRTEGLIPIQMMRDI++NEM Sbjct: 142 MQVRGLPTLFFISPDPNKDAIRTEGLIPIQMMRDIIDNEM 181 >gb|EYU38291.1| hypothetical protein MIMGU_mgv1a012971mg [Erythranthe guttata] Length = 232 Score = 81.6 bits (200), Expect = 4e-15 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDIL+N+M Sbjct: 193 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILDNDM 232 >ref|XP_006432437.1| thioredoxin-like protein CITRX, chloroplastic [Citrus clementina] ref|XP_006465751.1| PREDICTED: thioredoxin-like protein CITRX, chloroplastic [Citrus sinensis] ref|XP_006465752.1| PREDICTED: thioredoxin-like protein CITRX, chloroplastic [Citrus sinensis] gb|ESR45677.1| hypothetical protein CICLE_v10002629mg [Citrus clementina] gb|KDO58853.1| hypothetical protein CISIN_1g041160mg [Citrus sinensis] dbj|GAY58647.1| hypothetical protein CUMW_188580 [Citrus unshiu] Length = 182 Score = 80.5 bits (197), Expect = 4e-15 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 MQVRGLPTL+FISPDPNKDAIRTEGLIPIQMMRDI++NEM Sbjct: 143 MQVRGLPTLFFISPDPNKDAIRTEGLIPIQMMRDIIDNEM 182 >gb|EYU38290.1| hypothetical protein MIMGU_mgv1a012971mg [Erythranthe guttata] Length = 234 Score = 81.6 bits (200), Expect = 5e-15 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDIL+N+M Sbjct: 195 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILDNDM 234 >ref|XP_013644008.1| thioredoxin-like protein CITRX, chloroplastic [Brassica napus] Length = 76 Score = 77.4 bits (189), Expect = 5e-15 Identities = 35/40 (87%), Positives = 40/40 (100%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 MQVRGLPTL+FISPDP+KDAIRTEGLIPIQMMRDI++N+M Sbjct: 37 MQVRGLPTLFFISPDPSKDAIRTEGLIPIQMMRDIIDNDM 76 >ref|XP_021752903.1| thioredoxin-like protein CITRX, chloroplastic [Chenopodium quinoa] Length = 182 Score = 80.1 bits (196), Expect = 6e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 M VRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILEN+M Sbjct: 143 MLVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENDM 182 >ref|XP_012457198.1| PREDICTED: thioredoxin-like protein CITRX, chloroplastic [Gossypium raimondii] ref|XP_016699945.1| PREDICTED: thioredoxin-like protein CITRX, chloroplastic [Gossypium hirsutum] gb|KJB73128.1| hypothetical protein B456_011G216600 [Gossypium raimondii] Length = 172 Score = 79.7 bits (195), Expect = 7e-15 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 MQVRGLPTL+FISPDPNK+AIRTEGLIPIQMMRDIL+NEM Sbjct: 133 MQVRGLPTLFFISPDPNKEAIRTEGLIPIQMMRDILDNEM 172 >ref|XP_017647132.1| PREDICTED: thioredoxin-like protein CITRX, chloroplastic [Gossypium arboreum] gb|KHG21145.1| hypothetical protein F383_01634 [Gossypium arboreum] Length = 172 Score = 79.7 bits (195), Expect = 7e-15 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 MQVRGLPTL+FISPDPNK+AIRTEGLIPIQMMRDIL+NEM Sbjct: 133 MQVRGLPTLFFISPDPNKEAIRTEGLIPIQMMRDILDNEM 172 >ref|XP_021299948.1| thioredoxin-like protein CITRX, chloroplastic [Herrania umbratica] Length = 173 Score = 79.7 bits (195), Expect = 7e-15 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 MQVRGLPTL+FISPDPNK+AIRTEGLIPIQMMRDIL+NEM Sbjct: 134 MQVRGLPTLFFISPDPNKEAIRTEGLIPIQMMRDILDNEM 173 >ref|XP_007010928.1| PREDICTED: thioredoxin-like protein CITRX, chloroplastic [Theobroma cacao] gb|EOY19738.1| Thioredoxin z, P,TRX z isoform 1 [Theobroma cacao] Length = 173 Score = 79.7 bits (195), Expect = 7e-15 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 MQVRGLPTL+FISPDPNK+AIRTEGLIPIQMMRDIL+NEM Sbjct: 134 MQVRGLPTLFFISPDPNKEAIRTEGLIPIQMMRDILDNEM 173 >gb|PHU09808.1| Thioredoxin-like protein CITRX, chloroplastic [Capsicum chinense] Length = 174 Score = 79.7 bits (195), Expect = 7e-15 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 1 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDILENEM 120 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDI++N++ Sbjct: 135 MQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDIIDNDL 174