BLASTX nr result
ID: Rehmannia32_contig00008954
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00008954 (568 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN21368.1| P-type ATPase [Handroanthus impetiginosus] 64 2e-08 ref|XP_012832277.1| PREDICTED: phospholipid-transporting ATPase ... 57 6e-06 >gb|PIN21368.1| P-type ATPase [Handroanthus impetiginosus] Length = 1318 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 3/43 (6%) Frame = -2 Query: 129 MSSDKPLLSQSELFSSPNPQ---PHHRRHSSLRIGSLGCLCPT 10 MSSDKPLLS+SE S+PNPQ HHRRHSSLRI LGCLC T Sbjct: 1 MSSDKPLLSESEPLSAPNPQHHHHHHRRHSSLRINPLGCLCHT 43 >ref|XP_012832277.1| PREDICTED: phospholipid-transporting ATPase 1-like [Erythranthe guttata] Length = 1306 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/41 (70%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = -2 Query: 129 MSSDKPLLSQSELFSSPNPQP-HHRRHSSLRIGSLGCLCPT 10 MSSDKPLLSQ E +PNPQP HHRRHSSL+ LGCL T Sbjct: 1 MSSDKPLLSQFEPSYAPNPQPHHHRRHSSLKNNPLGCLSET 41