BLASTX nr result
ID: Rehmannia32_contig00008920
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00008920 (511 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100264.1| probable serine/threonine-protein kinase At1... 70 6e-11 ref|XP_012852454.1| PREDICTED: probable serine/threonine-protein... 70 8e-11 gb|KZV24382.1| putative serine/threonine-protein kinase-like [Do... 67 7e-10 >ref|XP_011100264.1| probable serine/threonine-protein kinase At1g54610 [Sesamum indicum] Length = 700 Score = 70.5 bits (171), Expect = 6e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 115 MGCVCGKPSSAVKDSEESPKQRELIRKTSELRVARAVS 2 MGCVCGKPSSAVK SEESPKQRELI+KTSELR ARA+S Sbjct: 1 MGCVCGKPSSAVKASEESPKQRELIKKTSELREARAIS 38 >ref|XP_012852454.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 [Erythranthe guttata] gb|EYU24917.1| hypothetical protein MIMGU_mgv1a002276mg [Erythranthe guttata] Length = 692 Score = 70.1 bits (170), Expect = 8e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -1 Query: 115 MGCVCGKPSSAVKDSEESPKQRELIRKTSELRVARAVS 2 MGCVCGKPSSAVK+S +SPKQREL+RKTSELRVARA+S Sbjct: 1 MGCVCGKPSSAVKNSGDSPKQRELMRKTSELRVARAIS 38 >gb|KZV24382.1| putative serine/threonine-protein kinase-like [Dorcoceras hygrometricum] Length = 696 Score = 67.4 bits (163), Expect = 7e-10 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -1 Query: 115 MGCVCGKPSSAVKDSEESPKQRELIRKTSELRVARAVS 2 MGCVCGK SS KDSEESPKQRELIRKTSELR ARA+S Sbjct: 1 MGCVCGKTSSVSKDSEESPKQRELIRKTSELRGARAIS 38