BLASTX nr result
ID: Rehmannia32_contig00008510
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00008510 (540 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV56018.1| hypothetical protein F511_12717 [Dorcoceras hygro... 64 1e-08 >gb|KZV56018.1| hypothetical protein F511_12717 [Dorcoceras hygrometricum] Length = 313 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 27 KKIPSQFNPADMGTKCLPVSKFLSCLKILNCDTGD 131 +KIPS++NPADMGTKCLPVSKF+SCLKIL DT D Sbjct: 279 EKIPSEYNPADMGTKCLPVSKFMSCLKILKFDTCD 313