BLASTX nr result
ID: Rehmannia32_contig00008398
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00008398 (476 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44780.1| hypothetical protein MIMGU_mgv1a004985mg [Erythra... 59 5e-07 ref|XP_012849820.1| PREDICTED: formin-like protein 7 [Erythranth... 59 5e-07 ref|XP_011098435.1| protein diaphanous homolog 1 [Sesamum indicum] 57 2e-06 gb|PIN21824.1| hypothetical protein CDL12_05457 [Handroanthus im... 57 3e-06 >gb|EYU44780.1| hypothetical protein MIMGU_mgv1a004985mg [Erythranthe guttata] Length = 501 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +2 Query: 2 AQLQIAKLQIPKVEQVESKNTAHPGSTHTGVSPHQQFSNV 121 AQ+QIAK+ PKVEQVESKNTAH ST TGV HQQ+S V Sbjct: 159 AQVQIAKMLNPKVEQVESKNTAHMDSTQTGVPTHQQYSTV 198 >ref|XP_012849820.1| PREDICTED: formin-like protein 7 [Erythranthe guttata] Length = 558 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +2 Query: 2 AQLQIAKLQIPKVEQVESKNTAHPGSTHTGVSPHQQFSNV 121 AQ+QIAK+ PKVEQVESKNTAH ST TGV HQQ+S V Sbjct: 216 AQVQIAKMLNPKVEQVESKNTAHMDSTQTGVPTHQQYSTV 255 >ref|XP_011098435.1| protein diaphanous homolog 1 [Sesamum indicum] Length = 564 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +2 Query: 2 AQLQIAKLQIPKVEQVESKNTAHPGSTHTGVSPHQQFS 115 AQL IAKLQ+PKVEQV+SKNTAH S+ TGV QQFS Sbjct: 216 AQLHIAKLQVPKVEQVDSKNTAHTDSSQTGVPAPQQFS 253 >gb|PIN21824.1| hypothetical protein CDL12_05457 [Handroanthus impetiginosus] Length = 586 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/41 (70%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = +2 Query: 2 AQLQIAKLQI-PKVEQVESKNTAHPGSTHTGVSPHQQFSNV 121 AQLQIAK+Q+ PKVEQV+SKNT H ST TGVS +QQFS + Sbjct: 216 AQLQIAKVQVSPKVEQVQSKNTTHSDSTQTGVSSNQQFSAI 256