BLASTX nr result
ID: Rehmannia32_contig00008239
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00008239 (388 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076247.1| calcium-dependent protein kinase 26-like iso... 64 4e-09 ref|XP_011076246.1| calcium-dependent protein kinase 26-like iso... 64 4e-09 gb|PIN26802.1| hypothetical protein CDL12_00426 [Handroanthus im... 60 2e-08 gb|OMP09639.1| calcium-dependent protein kinase 34-like protein ... 57 7e-08 gb|PIN16672.1| Ca2+/calmodulin-dependent protein kinase, EF-Hand... 59 2e-07 ref|XP_012851975.1| PREDICTED: calcium-dependent protein kinase ... 57 8e-07 ref|XP_007040113.1| PREDICTED: calcium-dependent protein kinase ... 57 8e-07 ref|XP_021279703.1| calcium/calmodulin-dependent protein kinase ... 57 8e-07 gb|EOY24613.1| Phosphoenolpyruvate carboxylase-related kinase 1 ... 57 8e-07 gb|EOY23078.1| Phosphoenolpyruvate carboxylase-related kinase 1 ... 57 1e-06 gb|EOY23077.1| Phosphoenolpyruvate carboxylase-related kinase 1 ... 57 1e-06 ref|XP_012440214.1| PREDICTED: calcium-dependent protein kinase ... 57 1e-06 ref|XP_017637852.1| PREDICTED: calcium-dependent protein kinase ... 57 1e-06 gb|EOY23076.1| Phosphoenolpyruvate carboxylase-related kinase 1 ... 57 1e-06 ref|XP_021281411.1| calcium-dependent protein kinase 26-like [He... 57 1e-06 ref|XP_007038574.2| PREDICTED: calcium-dependent protein kinase ... 57 1e-06 gb|EOY23075.1| Phosphoenolpyruvate carboxylase-related kinase 1 ... 57 1e-06 ref|XP_022736680.1| calcium-dependent protein kinase 26-like [Du... 56 1e-06 gb|ARJ54932.1| calcium-dependent protein kinases 5 [Camellia sin... 56 1e-06 ref|XP_019191794.1| PREDICTED: calcium-dependent protein kinase ... 56 1e-06 >ref|XP_011076247.1| calcium-dependent protein kinase 26-like isoform X2 [Sesamum indicum] Length = 494 Score = 63.5 bits (153), Expect = 4e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLVC 293 EH DL VTESVIRWASCT+LPTATSFRSSLVC Sbjct: 463 EHLDLVVTESVIRWASCTHLPTATSFRSSLVC 494 >ref|XP_011076246.1| calcium-dependent protein kinase 26-like isoform X1 [Sesamum indicum] Length = 495 Score = 63.5 bits (153), Expect = 4e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLVC 293 EH DL VTESVIRWASCT+LPTATSFRSSLVC Sbjct: 464 EHLDLVVTESVIRWASCTHLPTATSFRSSLVC 495 >gb|PIN26802.1| hypothetical protein CDL12_00426 [Handroanthus impetiginosus] Length = 165 Score = 59.7 bits (143), Expect = 2e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLVC 293 E DLTV+ESVIRWASCTN+P ATSFRSSLVC Sbjct: 134 EQLDLTVSESVIRWASCTNIPIATSFRSSLVC 165 >gb|OMP09639.1| calcium-dependent protein kinase 34-like protein [Corchorus olitorius] Length = 114 Score = 57.0 bits (136), Expect = 7e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLVC 293 +HFDL VTESVIRWASCT++PTA S R SLVC Sbjct: 83 DHFDLVVTESVIRWASCTHIPTAPSLRLSLVC 114 >gb|PIN16672.1| Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Handroanthus impetiginosus] Length = 496 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLVC 293 EH D+ TESVIRWASCT+LPTATS RSSLVC Sbjct: 465 EHIDIITTESVIRWASCTHLPTATSLRSSLVC 496 >ref|XP_012851975.1| PREDICTED: calcium-dependent protein kinase 1-like [Erythranthe guttata] ref|XP_012851976.1| PREDICTED: calcium-dependent protein kinase 1-like [Erythranthe guttata] ref|XP_012851977.1| PREDICTED: calcium-dependent protein kinase 1-like [Erythranthe guttata] gb|EYU25048.1| hypothetical protein MIMGU_mgv1a005528mg [Erythranthe guttata] Length = 480 Score = 57.0 bits (136), Expect = 8e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLV 296 E DL VTESVIRWASCT+LPTATSFRSSLV Sbjct: 449 EQIDLVVTESVIRWASCTHLPTATSFRSSLV 479 >ref|XP_007040113.1| PREDICTED: calcium-dependent protein kinase 26 [Theobroma cacao] gb|EOY24614.1| Phosphoenolpyruvate carboxylase-related kinase 1, putative isoform 2 [Theobroma cacao] Length = 522 Score = 57.0 bits (136), Expect = 8e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLVC 293 +HFDL VTESVIRWASCT++PTA S R SLVC Sbjct: 491 DHFDLVVTESVIRWASCTHIPTAPSLRLSLVC 522 >ref|XP_021279703.1| calcium/calmodulin-dependent protein kinase type 1 [Herrania umbratica] Length = 557 Score = 57.0 bits (136), Expect = 8e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLVC 293 +HFDL VTESVIRWASCT++PTA S R SLVC Sbjct: 526 DHFDLVVTESVIRWASCTHIPTAPSLRLSLVC 557 >gb|EOY24613.1| Phosphoenolpyruvate carboxylase-related kinase 1 isoform 1 [Theobroma cacao] Length = 557 Score = 57.0 bits (136), Expect = 8e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLVC 293 +HFDL VTESVIRWASCT++PTA S R SLVC Sbjct: 526 DHFDLVVTESVIRWASCTHIPTAPSLRLSLVC 557 >gb|EOY23078.1| Phosphoenolpyruvate carboxylase-related kinase 1 isoform 4 [Theobroma cacao] Length = 419 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLVC 293 E D V+ESVIRWASCTNLPTATS RSSLVC Sbjct: 388 EQLDFMVSESVIRWASCTNLPTATSLRSSLVC 419 >gb|EOY23077.1| Phosphoenolpyruvate carboxylase-related kinase 1 isoform 3 [Theobroma cacao] Length = 466 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLVC 293 E D V+ESVIRWASCTNLPTATS RSSLVC Sbjct: 435 EQLDFMVSESVIRWASCTNLPTATSLRSSLVC 466 >ref|XP_012440214.1| PREDICTED: calcium-dependent protein kinase 26-like [Gossypium raimondii] ref|XP_016737357.1| PREDICTED: calcium-dependent protein kinase 26-like [Gossypium hirsutum] gb|KJB52871.1| hypothetical protein B456_008G280900 [Gossypium raimondii] Length = 510 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLVC 293 E D V+ESVIRWASCTNLPTATS RSSLVC Sbjct: 479 EQLDFIVSESVIRWASCTNLPTATSLRSSLVC 510 >ref|XP_017637852.1| PREDICTED: calcium-dependent protein kinase 26-like [Gossypium arboreum] gb|KHG15844.1| Calcium-dependent protein kinase 34 [Gossypium arboreum] Length = 510 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLVC 293 E D V+ESVIRWASCTNLPTATS RSSLVC Sbjct: 479 EQLDFIVSESVIRWASCTNLPTATSLRSSLVC 510 >gb|EOY23076.1| Phosphoenolpyruvate carboxylase-related kinase 1 isoform 2 [Theobroma cacao] Length = 516 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLVC 293 E D V+ESVIRWASCTNLPTATS RSSLVC Sbjct: 485 EQLDFMVSESVIRWASCTNLPTATSLRSSLVC 516 >ref|XP_021281411.1| calcium-dependent protein kinase 26-like [Herrania umbratica] ref|XP_021281420.1| calcium-dependent protein kinase 26-like [Herrania umbratica] ref|XP_021281428.1| calcium-dependent protein kinase 26-like [Herrania umbratica] ref|XP_021281437.1| calcium-dependent protein kinase 26-like [Herrania umbratica] Length = 518 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLVC 293 E D V+ESVIRWASCTNLPTATS RSSLVC Sbjct: 487 EQLDFMVSESVIRWASCTNLPTATSLRSSLVC 518 >ref|XP_007038574.2| PREDICTED: calcium-dependent protein kinase 26 [Theobroma cacao] ref|XP_017972961.1| PREDICTED: calcium-dependent protein kinase 26 [Theobroma cacao] Length = 518 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLVC 293 E D V+ESVIRWASCTNLPTATS RSSLVC Sbjct: 487 EQLDFMVSESVIRWASCTNLPTATSLRSSLVC 518 >gb|EOY23075.1| Phosphoenolpyruvate carboxylase-related kinase 1 isoform 1 [Theobroma cacao] Length = 518 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLVC 293 E D V+ESVIRWASCTNLPTATS RSSLVC Sbjct: 487 EQLDFMVSESVIRWASCTNLPTATSLRSSLVC 518 >ref|XP_022736680.1| calcium-dependent protein kinase 26-like [Durio zibethinus] ref|XP_022736681.1| calcium-dependent protein kinase 26-like [Durio zibethinus] ref|XP_022736682.1| calcium-dependent protein kinase 26-like [Durio zibethinus] Length = 518 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLVC 293 E D V ESVIRWASCTNLPTATS RSSLVC Sbjct: 487 EQLDFIVAESVIRWASCTNLPTATSLRSSLVC 518 >gb|ARJ54932.1| calcium-dependent protein kinases 5 [Camellia sinensis] Length = 522 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLVC 293 + DL VTESVIRWASCT LPTATS RSSLVC Sbjct: 491 DQIDLMVTESVIRWASCTQLPTATSLRSSLVC 522 >ref|XP_019191794.1| PREDICTED: calcium-dependent protein kinase 26 [Ipomoea nil] Length = 522 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = -1 Query: 388 EHFDLTVTESVIRWASCTNLPTATSFRSSLVC 293 E DL VTESVIRWASCT LPTATS RSSLVC Sbjct: 491 EQLDLMVTESVIRWASCTCLPTATSLRSSLVC 522