BLASTX nr result
ID: Rehmannia32_contig00008102
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00008102 (456 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN22940.1| hypothetical protein CDL12_04349 [Handroanthus im... 56 1e-06 >gb|PIN22940.1| hypothetical protein CDL12_04349 [Handroanthus impetiginosus] Length = 192 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 1/74 (1%) Frame = -1 Query: 453 EKQQQNDTWYSKNGYSGYGKLKNGNKYSD-SMSPDVETGYGAHQGSRMSMDKPGPVYSEQ 277 E ++ +TW N + G GK ++ N+Y S + GYG HQG M + P Y Sbjct: 121 EDEEDYNTWNGVNDHFGLGKHQDANRYPGMSYGLEKSWGYGVHQGPHKPMVELRPYYI-- 178 Query: 276 NKAPPVWCAKGIVD 235 + APPVWCAKG+ D Sbjct: 179 SAAPPVWCAKGVKD 192