BLASTX nr result
ID: Rehmannia32_contig00007727
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00007727 (461 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098139.1| endoplasmic reticulum oxidoreductin-1 [Sesam... 136 4e-35 ref|XP_022877700.1| endoplasmic reticulum oxidoreductin-1, parti... 135 1e-34 gb|EYU26254.1| hypothetical protein MIMGU_mgv1a0070612mg, partia... 132 1e-34 emb|CDP06120.1| unnamed protein product [Coffea canephora] 134 4e-34 ref|XP_012850538.1| PREDICTED: endoplasmic reticulum oxidoreduct... 132 7e-34 ref|XP_016456734.1| PREDICTED: endoplasmic reticulum oxidoreduct... 128 7e-34 gb|KZV50382.1| endoplasmic reticulum oxidoreductin-1 [Dorcoceras... 132 1e-33 ref|XP_016554088.1| PREDICTED: endoplasmic reticulum oxidoreduct... 128 3e-33 ref|XP_019193410.1| PREDICTED: endoplasmic reticulum oxidoreduct... 130 4e-33 ref|XP_016456732.1| PREDICTED: endoplasmic reticulum oxidoreduct... 128 4e-33 gb|PIN14410.1| Endoplasmic reticulum membrane-associated oxidore... 132 5e-33 ref|XP_019193409.1| PREDICTED: endoplasmic reticulum oxidoreduct... 130 6e-33 ref|XP_019193408.1| PREDICTED: endoplasmic reticulum oxidoreduct... 130 6e-33 ref|XP_004243200.1| PREDICTED: endoplasmic reticulum oxidoreduct... 130 1e-32 ref|XP_015080567.1| PREDICTED: endoplasmic reticulum oxidoreduct... 130 1e-32 ref|XP_006366773.1| PREDICTED: endoplasmic reticulum oxidoreduct... 130 1e-32 gb|PHT76928.1| Endoplasmic reticulum oxidoreductin-1 [Capsicum a... 128 5e-32 gb|PHT43685.1| Endoplasmic reticulum oxidoreductin-1 [Capsicum b... 128 5e-32 ref|XP_019249552.1| PREDICTED: endoplasmic reticulum oxidoreduct... 128 5e-32 ref|XP_009769219.1| PREDICTED: endoplasmic reticulum oxidoreduct... 128 5e-32 >ref|XP_011098139.1| endoplasmic reticulum oxidoreductin-1 [Sesamum indicum] Length = 472 Score = 136 bits (343), Expect = 4e-35 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 KSCQC QDSRKYTGIVEDCCCDYETVDSLNG VLHPLLQ+LVRTPFFRYFKVKLWCDCPF Sbjct: 51 KSCQCPQDSRKYTGIVEDCCCDYETVDSLNGGVLHPLLQELVRTPFFRYFKVKLWCDCPF 110 Query: 5 W 3 W Sbjct: 111 W 111 >ref|XP_022877700.1| endoplasmic reticulum oxidoreductin-1, partial [Olea europaea var. sylvestris] Length = 452 Score = 135 bits (339), Expect = 1e-34 Identities = 57/61 (93%), Positives = 60/61 (98%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 KSC+C+QDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQ+LV TPFFRYFKVKLWCDCPF Sbjct: 44 KSCRCAQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQELVTTPFFRYFKVKLWCDCPF 103 Query: 5 W 3 W Sbjct: 104 W 104 >gb|EYU26254.1| hypothetical protein MIMGU_mgv1a0070612mg, partial [Erythranthe guttata] Length = 336 Score = 132 bits (333), Expect = 1e-34 Identities = 55/61 (90%), Positives = 60/61 (98%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 KSC CSQD+RKYTGIVEDCCCDYETVDS+NGAVLHPLLQ+LV+TPFFRY+KVKLWCDCPF Sbjct: 22 KSCLCSQDARKYTGIVEDCCCDYETVDSVNGAVLHPLLQELVKTPFFRYYKVKLWCDCPF 81 Query: 5 W 3 W Sbjct: 82 W 82 >emb|CDP06120.1| unnamed protein product [Coffea canephora] Length = 473 Score = 134 bits (336), Expect = 4e-34 Identities = 56/60 (93%), Positives = 59/60 (98%) Frame = -1 Query: 182 SCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPFW 3 SCQC+QDSRKYTGIVEDCCCDYETVDS+NGAVLHPLLQ+LV TPFFRYFKVKLWCDCPFW Sbjct: 49 SCQCAQDSRKYTGIVEDCCCDYETVDSINGAVLHPLLQELVTTPFFRYFKVKLWCDCPFW 108 >ref|XP_012850538.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Erythranthe guttata] Length = 440 Score = 132 bits (333), Expect = 7e-34 Identities = 55/61 (90%), Positives = 60/61 (98%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 KSC CSQD+RKYTGIVEDCCCDYETVDS+NGAVLHPLLQ+LV+TPFFRY+KVKLWCDCPF Sbjct: 48 KSCLCSQDARKYTGIVEDCCCDYETVDSVNGAVLHPLLQELVKTPFFRYYKVKLWCDCPF 107 Query: 5 W 3 W Sbjct: 108 W 108 >ref|XP_016456734.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X2 [Nicotiana tabacum] Length = 238 Score = 128 bits (321), Expect = 7e-34 Identities = 54/61 (88%), Positives = 56/61 (91%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 K C C QDSRKYTGIVEDCCCDYETVD++NGAVLHPLLQ LV TPFFRYFKVKLWCDCPF Sbjct: 50 KPCPCFQDSRKYTGIVEDCCCDYETVDAINGAVLHPLLQGLVTTPFFRYFKVKLWCDCPF 109 Query: 5 W 3 W Sbjct: 110 W 110 >gb|KZV50382.1| endoplasmic reticulum oxidoreductin-1 [Dorcoceras hygrometricum] Length = 461 Score = 132 bits (332), Expect = 1e-33 Identities = 55/61 (90%), Positives = 59/61 (96%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 KSC CSQDSRKYTGIVEDCCCDYET+DS+N AVLHPLLQ+LV+TPFFRYFKVKLWCDCPF Sbjct: 51 KSCHCSQDSRKYTGIVEDCCCDYETIDSVNEAVLHPLLQELVKTPFFRYFKVKLWCDCPF 110 Query: 5 W 3 W Sbjct: 111 W 111 >ref|XP_016554088.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Capsicum annuum] Length = 305 Score = 128 bits (321), Expect = 3e-33 Identities = 54/61 (88%), Positives = 57/61 (93%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 KSC C QDS KYTGIVEDCCCDYETVD++NGAVLHPLLQ+LV TPFFRYFKVKLWCDCPF Sbjct: 47 KSCPCIQDSIKYTGIVEDCCCDYETVDTINGAVLHPLLQELVTTPFFRYFKVKLWCDCPF 106 Query: 5 W 3 W Sbjct: 107 W 107 >ref|XP_019193410.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X3 [Ipomoea nil] Length = 441 Score = 130 bits (328), Expect = 4e-33 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 KSC C+QDSRKYTGIVEDCCCDYETVD+LN AVLHPLLQ+LV TPFFRYFKVKLWCDCPF Sbjct: 49 KSCPCAQDSRKYTGIVEDCCCDYETVDTLNAAVLHPLLQELVTTPFFRYFKVKLWCDCPF 108 Query: 5 W 3 W Sbjct: 109 W 109 >ref|XP_016456732.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X1 [Nicotiana tabacum] Length = 310 Score = 128 bits (321), Expect = 4e-33 Identities = 54/61 (88%), Positives = 56/61 (91%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 K C C QDSRKYTGIVEDCCCDYETVD++NGAVLHPLLQ LV TPFFRYFKVKLWCDCPF Sbjct: 50 KPCPCFQDSRKYTGIVEDCCCDYETVDAINGAVLHPLLQGLVTTPFFRYFKVKLWCDCPF 109 Query: 5 W 3 W Sbjct: 110 W 110 >gb|PIN14410.1| Endoplasmic reticulum membrane-associated oxidoreductin involved in disulfide bond formation [Handroanthus impetiginosus] Length = 569 Score = 132 bits (331), Expect = 5e-33 Identities = 56/61 (91%), Positives = 59/61 (96%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 KSC CS+DS+KYTGIVEDCCCDYETVDSLNGAVLHPLLQ+LV TPFFRYFKVKLWCDCPF Sbjct: 49 KSCLCSKDSQKYTGIVEDCCCDYETVDSLNGAVLHPLLQELVTTPFFRYFKVKLWCDCPF 108 Query: 5 W 3 W Sbjct: 109 W 109 >ref|XP_019193409.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X2 [Ipomoea nil] Length = 477 Score = 130 bits (328), Expect = 6e-33 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 KSC C+QDSRKYTGIVEDCCCDYETVD+LN AVLHPLLQ+LV TPFFRYFKVKLWCDCPF Sbjct: 49 KSCPCAQDSRKYTGIVEDCCCDYETVDTLNAAVLHPLLQELVTTPFFRYFKVKLWCDCPF 108 Query: 5 W 3 W Sbjct: 109 W 109 >ref|XP_019193408.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X1 [Ipomoea nil] Length = 478 Score = 130 bits (328), Expect = 6e-33 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 KSC C+QDSRKYTGIVEDCCCDYETVD+LN AVLHPLLQ+LV TPFFRYFKVKLWCDCPF Sbjct: 49 KSCPCAQDSRKYTGIVEDCCCDYETVDTLNAAVLHPLLQELVTTPFFRYFKVKLWCDCPF 108 Query: 5 W 3 W Sbjct: 109 W 109 >ref|XP_004243200.1| PREDICTED: endoplasmic reticulum oxidoreductin-1 [Solanum lycopersicum] Length = 473 Score = 130 bits (326), Expect = 1e-32 Identities = 55/61 (90%), Positives = 57/61 (93%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 KSC C QDSRKYTGIVEDCCCDYETVD++NGAVLHPLLQ LV TPFFRYFKVKLWCDCPF Sbjct: 50 KSCPCFQDSRKYTGIVEDCCCDYETVDAINGAVLHPLLQGLVTTPFFRYFKVKLWCDCPF 109 Query: 5 W 3 W Sbjct: 110 W 110 >ref|XP_015080567.1| PREDICTED: endoplasmic reticulum oxidoreductin-1 [Solanum pennellii] Length = 474 Score = 130 bits (326), Expect = 1e-32 Identities = 55/61 (90%), Positives = 57/61 (93%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 KSC C QDSRKYTGIVEDCCCDYETVD++NGAVLHPLLQ LV TPFFRYFKVKLWCDCPF Sbjct: 50 KSCPCFQDSRKYTGIVEDCCCDYETVDAINGAVLHPLLQGLVTTPFFRYFKVKLWCDCPF 109 Query: 5 W 3 W Sbjct: 110 W 110 >ref|XP_006366773.1| PREDICTED: endoplasmic reticulum oxidoreductin-1 [Solanum tuberosum] Length = 474 Score = 130 bits (326), Expect = 1e-32 Identities = 55/61 (90%), Positives = 57/61 (93%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 KSC C QDSRKYTGIVEDCCCDYETVD++NGAVLHPLLQ LV TPFFRYFKVKLWCDCPF Sbjct: 50 KSCPCFQDSRKYTGIVEDCCCDYETVDTINGAVLHPLLQGLVTTPFFRYFKVKLWCDCPF 109 Query: 5 W 3 W Sbjct: 110 W 110 >gb|PHT76928.1| Endoplasmic reticulum oxidoreductin-1 [Capsicum annuum] Length = 469 Score = 128 bits (321), Expect = 5e-32 Identities = 54/61 (88%), Positives = 57/61 (93%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 KSC C QDS KYTGIVEDCCCDYETVD++NGAVLHPLLQ+LV TPFFRYFKVKLWCDCPF Sbjct: 47 KSCPCIQDSIKYTGIVEDCCCDYETVDTINGAVLHPLLQELVTTPFFRYFKVKLWCDCPF 106 Query: 5 W 3 W Sbjct: 107 W 107 >gb|PHT43685.1| Endoplasmic reticulum oxidoreductin-1 [Capsicum baccatum] Length = 469 Score = 128 bits (321), Expect = 5e-32 Identities = 54/61 (88%), Positives = 57/61 (93%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 KSC C QDS KYTGIVEDCCCDYETVD++NGAVLHPLLQ+LV TPFFRYFKVKLWCDCPF Sbjct: 47 KSCPCIQDSIKYTGIVEDCCCDYETVDTINGAVLHPLLQELVTTPFFRYFKVKLWCDCPF 106 Query: 5 W 3 W Sbjct: 107 W 107 >ref|XP_019249552.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Nicotiana attenuata] gb|OIT00267.1| endoplasmic reticulum oxidoreductin-1 [Nicotiana attenuata] Length = 474 Score = 128 bits (321), Expect = 5e-32 Identities = 54/61 (88%), Positives = 56/61 (91%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 K C C QDSRKYTGIVEDCCCDYETVD++NGAVLHPLLQ LV TPFFRYFKVKLWCDCPF Sbjct: 50 KPCPCFQDSRKYTGIVEDCCCDYETVDTINGAVLHPLLQGLVTTPFFRYFKVKLWCDCPF 109 Query: 5 W 3 W Sbjct: 110 W 110 >ref|XP_009769219.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Nicotiana sylvestris] ref|XP_016501215.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Nicotiana tabacum] Length = 474 Score = 128 bits (321), Expect = 5e-32 Identities = 54/61 (88%), Positives = 56/61 (91%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 K C C QDSRKYTGIVEDCCCDYETVD++NGAVLHPLLQ LV TPFFRYFKVKLWCDCPF Sbjct: 50 KPCPCFQDSRKYTGIVEDCCCDYETVDAINGAVLHPLLQGLVTTPFFRYFKVKLWCDCPF 109 Query: 5 W 3 W Sbjct: 110 W 110