BLASTX nr result
ID: Rehmannia32_contig00007481
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00007481 (472 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFB70984.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 92 2e-21 ref|XP_018451548.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 91 5e-21 gb|AFK38815.1| unknown [Lotus japonicus] 91 7e-21 gb|PKI47525.1| hypothetical protein CRG98_032115 [Punica granatum] 91 1e-20 ref|XP_023639865.1| 4-hydroxy-3-methylbut-2-enyl diphosphate red... 91 2e-20 gb|AGZ84565.1| glucosyltransferase KGT15, partial [Pueraria mont... 89 3e-20 gb|ABI30631.1| 1-hydroxy-2-methyl-butenyl 4-diphosphate reductas... 95 1e-19 gb|ABV89582.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 95 1e-19 gb|AAK94426.1|AF398145_1 LYTB-like protein 1, partial [Brassica ... 91 1e-19 ref|NP_001234728.1| 4-hydroxy-3-methylbut-2-enyl diphosphate red... 94 2e-19 emb|CDO97092.1| unnamed protein product [Coffea canephora] 93 2e-19 gb|ART66979.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate re... 94 3e-19 ref|XP_021599342.1| 4-hydroxy-3-methylbut-2-enyl diphosphate red... 94 3e-19 ref|XP_021599341.1| 4-hydroxy-3-methylbut-2-enyl diphosphate red... 94 3e-19 gb|AID55341.1| 1-hydroxy-2-methyl-butenyl 4-diphosphate reductas... 94 3e-19 gb|AAQ54537.1| LYTB-like protein, partial [Malus domestica] 86 3e-19 dbj|BAD94833.1| hypothetical protein [Arabidopsis thaliana] 90 3e-19 ref|NP_001274899.1| 4-hydroxy-3-methylbut-2-enyl diphosphate red... 93 4e-19 ref|XP_002519102.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 93 4e-19 emb|CBI32545.3| unnamed protein product, partial [Vitis vinifera] 92 4e-19 >gb|AFB70984.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, partial [Mitragyna speciosa] Length = 96 Score = 92.0 bits (227), Expect = 2e-21 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKEN+LPEGPITIG+TSGASTPDKVVEDVLVKVFD+KREEALQLA Sbjct: 49 ELVEKENWLPEGPITIGVTSGASTPDKVVEDVLVKVFDLKREEALQLA 96 >ref|XP_018451548.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like [Raphanus sativus] Length = 96 Score = 91.3 bits (225), Expect = 5e-21 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKENFLP+GPITIG+TSGASTPDKVVEDVLVKVFDIKREE LQLA Sbjct: 49 ELVEKENFLPKGPITIGVTSGASTPDKVVEDVLVKVFDIKREELLQLA 96 >gb|AFK38815.1| unknown [Lotus japonicus] Length = 107 Score = 91.3 bits (225), Expect = 7e-21 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKENFLP+GPITIGITSGASTPDKVVEDVL+KVFD+KREE LQLA Sbjct: 60 ELVEKENFLPQGPITIGITSGASTPDKVVEDVLIKVFDLKREEVLQLA 107 >gb|PKI47525.1| hypothetical protein CRG98_032115 [Punica granatum] Length = 96 Score = 90.5 bits (223), Expect = 1e-20 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKEN+LPEGPITIG+TSGASTPDKVVEDVLVK+FDIKREE LQLA Sbjct: 49 ELVEKENWLPEGPITIGVTSGASTPDKVVEDVLVKIFDIKREEILQLA 96 >ref|XP_023639865.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic [Capsella rubella] Length = 154 Score = 91.3 bits (225), Expect = 2e-20 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKENFLP+GPITIG+TSGASTPDKVVEDVLVKVFDIKREE LQLA Sbjct: 106 ELVEKENFLPKGPITIGVTSGASTPDKVVEDVLVKVFDIKREELLQLA 153 >gb|AGZ84565.1| glucosyltransferase KGT15, partial [Pueraria montana var. lobata] Length = 94 Score = 89.4 bits (220), Expect = 3e-20 Identities = 42/48 (87%), Positives = 47/48 (97%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKEN+LPEGPITIG+TSGASTPDKVVED L+KVFD+KREEA+QLA Sbjct: 47 ELVEKENWLPEGPITIGVTSGASTPDKVVEDALIKVFDLKREEAMQLA 94 >gb|ABI30631.1| 1-hydroxy-2-methyl-butenyl 4-diphosphate reductase [Catharanthus roseus] Length = 462 Score = 94.7 bits (234), Expect = 1e-19 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKENFLPEGPITIG+TSGASTPDKVVEDVLVKVFDIKREEALQLA Sbjct: 415 ELVEKENFLPEGPITIGVTSGASTPDKVVEDVLVKVFDIKREEALQLA 462 >gb|ABV89582.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Rauvolfia verticillata] Length = 462 Score = 94.7 bits (234), Expect = 1e-19 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKENFLPEGPITIG+TSGASTPDKVVEDVLVKVFDIKREEALQLA Sbjct: 415 ELVEKENFLPEGPITIGVTSGASTPDKVVEDVLVKVFDIKREEALQLA 462 >gb|AAK94426.1|AF398145_1 LYTB-like protein 1, partial [Brassica rapa subsp. pekinensis] Length = 221 Score = 91.3 bits (225), Expect = 1e-19 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKENFLP+GPITIG+TSGASTPDKVVEDVLVKVFDIKREE LQLA Sbjct: 174 ELVEKENFLPKGPITIGVTSGASTPDKVVEDVLVKVFDIKREELLQLA 221 >ref|NP_001234728.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Solanum lycopersicum] ref|XP_015056327.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic [Solanum pennellii] gb|ACY27516.1| ISPH protein [Solanum lycopersicum] Length = 461 Score = 94.0 bits (232), Expect = 2e-19 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKENFLPEGPIT+G+TSGASTPDKVVEDVL+KVFDIKREEALQLA Sbjct: 414 ELVEKENFLPEGPITVGVTSGASTPDKVVEDVLIKVFDIKREEALQLA 461 >emb|CDO97092.1| unnamed protein product [Coffea canephora] Length = 381 Score = 93.2 bits (230), Expect = 2e-19 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKENFLPEGPITIG+TSGASTPDKVVEDVLVKVFDIKREE LQLA Sbjct: 334 ELVEKENFLPEGPITIGVTSGASTPDKVVEDVLVKVFDIKREEVLQLA 381 >gb|ART66979.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase 1 [Magnolia champaca] Length = 460 Score = 93.6 bits (231), Expect = 3e-19 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKENFLPEGPITIGITSGASTPDKVVEDVL+KVFDIKREE+LQLA Sbjct: 413 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLIKVFDIKREESLQLA 460 >ref|XP_021599342.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like isoform X2 [Manihot esculenta] Length = 462 Score = 93.6 bits (231), Expect = 3e-19 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKENFLPEGPITIG+TSGASTPDKVVEDVLVKVFDIKREEALQ+A Sbjct: 415 ELVEKENFLPEGPITIGVTSGASTPDKVVEDVLVKVFDIKREEALQVA 462 >ref|XP_021599341.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like isoform X1 [Manihot esculenta] gb|OAY25484.1| hypothetical protein MANES_17G098700 [Manihot esculenta] Length = 462 Score = 93.6 bits (231), Expect = 3e-19 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKENFLPEGPITIG+TSGASTPDKVVEDVLVKVFDIKREEALQ+A Sbjct: 415 ELVEKENFLPEGPITIGVTSGASTPDKVVEDVLVKVFDIKREEALQVA 462 >gb|AID55341.1| 1-hydroxy-2-methyl-butenyl 4-diphosphate reductase [Actinidia deliciosa] Length = 465 Score = 93.6 bits (231), Expect = 3e-19 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKENF+PEGPITIG+TSGASTPDKVVEDVL+KVFDIKREEALQLA Sbjct: 418 ELVEKENFIPEGPITIGVTSGASTPDKVVEDVLIKVFDIKREEALQLA 465 >gb|AAQ54537.1| LYTB-like protein, partial [Malus domestica] Length = 71 Score = 85.9 bits (211), Expect = 3e-19 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKEN+LPEGP+TIG+TSGASTPDKVVED L+++FD+KREE LQLA Sbjct: 24 ELVEKENWLPEGPVTIGVTSGASTPDKVVEDTLIRLFDLKREEVLQLA 71 >dbj|BAD94833.1| hypothetical protein [Arabidopsis thaliana] Length = 207 Score = 89.7 bits (221), Expect = 3e-19 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKENFLP+GPITIG+TSGASTPDKVVED LVKVFDIKREE LQLA Sbjct: 160 ELVEKENFLPKGPITIGVTSGASTPDKVVEDALVKVFDIKREELLQLA 207 >ref|NP_001274899.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like [Solanum tuberosum] gb|ABB55395.1| LYTB-like protein precursor-like [Solanum tuberosum] Length = 462 Score = 93.2 bits (230), Expect = 4e-19 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKENFLPEGPITIG+TSGASTPDKVVEDVL+K+FDIKREEALQLA Sbjct: 415 ELVEKENFLPEGPITIGVTSGASTPDKVVEDVLIKLFDIKREEALQLA 462 >ref|XP_002519102.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic [Ricinus communis] gb|EEF43313.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, putative [Ricinus communis] Length = 466 Score = 93.2 bits (230), Expect = 4e-19 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKENFLPEGPITIG+TSGASTPDKVVED LVKVFDIKREEALQLA Sbjct: 419 ELVEKENFLPEGPITIGVTSGASTPDKVVEDALVKVFDIKREEALQLA 466 >emb|CBI32545.3| unnamed protein product, partial [Vitis vinifera] Length = 380 Score = 92.4 bits (228), Expect = 4e-19 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = +1 Query: 1 ELVEKENFLPEGPITIGITSGASTPDKVVEDVLVKVFDIKREEALQLA 144 ELVEKEN+LPEGPITIG+TSGASTPDKVVEDVL+KVFDIKREEALQLA Sbjct: 333 ELVEKENWLPEGPITIGVTSGASTPDKVVEDVLIKVFDIKREEALQLA 380