BLASTX nr result
ID: Rehmannia32_contig00005153
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00005153 (506 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIA52713.1| hypothetical protein AQUCO_01000528v1 [Aquilegia ... 104 3e-25 gb|PIA52715.1| hypothetical protein AQUCO_01000528v1 [Aquilegia ... 104 7e-25 ref|XP_012837062.1| PREDICTED: protein RER1B [Erythranthe guttat... 103 1e-24 ref|XP_022895999.1| protein RER1A-like [Olea europaea var. sylve... 103 2e-24 ref|XP_022868711.1| protein RER1B-like [Olea europaea var. sylve... 102 4e-24 ref|XP_011088417.1| protein RER1A [Sesamum indicum] 102 6e-24 gb|KDO42014.1| hypothetical protein CISIN_1g0293781mg, partial [... 98 8e-24 ref|XP_010906341.1| PREDICTED: protein RER1B [Elaeis guineensis] 101 8e-24 gb|AFK41613.1| unknown [Lotus japonicus] 101 8e-24 ref|XP_022028383.1| protein RER1B-like [Helianthus annuus] >gi|1... 101 8e-24 ref|XP_019243208.1| PREDICTED: protein RER1A-like [Nicotiana att... 101 8e-24 ref|XP_009757328.1| PREDICTED: protein RER1A-like [Nicotiana syl... 101 8e-24 ref|XP_009596537.1| PREDICTED: protein RER1A-like [Nicotiana tom... 101 8e-24 ref|XP_006645429.1| PREDICTED: protein RER1A-like, partial [Oryz... 100 1e-23 dbj|BAJ87134.1| predicted protein [Hordeum vulgare subsp. vulgare] 101 1e-23 ref|XP_003569310.1| PREDICTED: protein RER1B [Brachypodium dista... 101 1e-23 emb|CDM81820.1| unnamed protein product [Triticum aestivum] 101 1e-23 ref|XP_006298620.1| protein RER1B [Capsella rubella] >gi|1338519... 100 2e-23 gb|PON86000.1| Retrieval of early ER protein Rer [Trema orientalis] 100 2e-23 ref|XP_022873024.1| protein RER1B-like [Olea europaea var. sylve... 100 2e-23 >gb|PIA52713.1| hypothetical protein AQUCO_01000528v1 [Aquilegia coerulea] Length = 153 Score = 104 bits (259), Expect = 3e-25 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 SMFDVPVFWPILLCYW+VLFVLTMKRQI+HMMKYKY+P N+GKQKYGGK Sbjct: 93 SMFDVPVFWPILLCYWIVLFVLTMKRQILHMMKYKYVPFNIGKQKYGGK 141 >gb|PIA52715.1| hypothetical protein AQUCO_01000528v1 [Aquilegia coerulea] gb|PIA52716.1| hypothetical protein AQUCO_01000528v1 [Aquilegia coerulea] Length = 194 Score = 104 bits (259), Expect = 7e-25 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 SMFDVPVFWPILLCYW+VLFVLTMKRQI+HMMKYKY+P N+GKQKYGGK Sbjct: 134 SMFDVPVFWPILLCYWIVLFVLTMKRQILHMMKYKYVPFNIGKQKYGGK 182 >ref|XP_012837062.1| PREDICTED: protein RER1B [Erythranthe guttata] gb|EYU37808.1| hypothetical protein MIMGU_mgv1a014299mg [Erythranthe guttata] Length = 194 Score = 103 bits (257), Expect = 1e-24 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIP N+GKQKY GK Sbjct: 134 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPFNIGKQKYRGK 182 >ref|XP_022895999.1| protein RER1A-like [Olea europaea var. sylvestris] ref|XP_022896000.1| protein RER1A-like [Olea europaea var. sylvestris] Length = 196 Score = 103 bits (257), Expect = 2e-24 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 SMFDVPVFWPILLCYW+VLF LTMKRQIMHM+KYKYIP NLGKQKYGGK Sbjct: 135 SMFDVPVFWPILLCYWIVLFALTMKRQIMHMIKYKYIPFNLGKQKYGGK 183 >ref|XP_022868711.1| protein RER1B-like [Olea europaea var. sylvestris] Length = 196 Score = 102 bits (254), Expect = 4e-24 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 SMFDVPVFWPILLCYW+VLF LTMKRQIMHM+KYKYIPLNLGKQKY GK Sbjct: 135 SMFDVPVFWPILLCYWVVLFALTMKRQIMHMIKYKYIPLNLGKQKYSGK 183 >ref|XP_011088417.1| protein RER1A [Sesamum indicum] Length = 195 Score = 102 bits (253), Expect = 6e-24 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHM+KYKYIP N+GKQKY GK Sbjct: 135 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMIKYKYIPFNIGKQKYRGK 183 >gb|KDO42014.1| hypothetical protein CISIN_1g0293781mg, partial [Citrus sinensis] gb|KDO42015.1| hypothetical protein CISIN_1g0293781mg, partial [Citrus sinensis] Length = 77 Score = 98.2 bits (243), Expect = 8e-24 Identities = 41/49 (83%), Positives = 47/49 (95%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 S+FDVPVFWPILLCYW+VLFVLTM+RQI HM+KY+YIP N+GKQKYGGK Sbjct: 17 SVFDVPVFWPILLCYWIVLFVLTMRRQIAHMIKYRYIPFNIGKQKYGGK 65 >ref|XP_010906341.1| PREDICTED: protein RER1B [Elaeis guineensis] Length = 193 Score = 101 bits (252), Expect = 8e-24 Identities = 42/49 (85%), Positives = 49/49 (100%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 S+FDVPVFWPILLCYW+VLFVLTMKRQI+HM+KYKY+PLN+GKQ+YGGK Sbjct: 134 SVFDVPVFWPILLCYWIVLFVLTMKRQILHMIKYKYVPLNMGKQRYGGK 182 >gb|AFK41613.1| unknown [Lotus japonicus] Length = 194 Score = 101 bits (252), Expect = 8e-24 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 S+FDVPVFWPILLCYW+VLFVLTM+RQI HM+KYKYIPLNLGKQKYGGK Sbjct: 134 SVFDVPVFWPILLCYWIVLFVLTMRRQIAHMIKYKYIPLNLGKQKYGGK 182 >ref|XP_022028383.1| protein RER1B-like [Helianthus annuus] ref|XP_022028384.1| protein RER1B-like [Helianthus annuus] gb|OTG31350.1| putative rer1 family protein [Helianthus annuus] Length = 194 Score = 101 bits (252), Expect = 8e-24 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 SMFDVPVFWPILLCYW VLF LTMKRQIMHM+KYKY+P N+GKQKYGGK Sbjct: 133 SMFDVPVFWPILLCYWFVLFTLTMKRQIMHMIKYKYVPFNIGKQKYGGK 181 >ref|XP_019243208.1| PREDICTED: protein RER1A-like [Nicotiana attenuata] gb|OIT04483.1| protein rer1a [Nicotiana attenuata] Length = 194 Score = 101 bits (252), Expect = 8e-24 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 S+FDVPVFWPILLCYW+VLFVLTMKRQIMHM+KYKYIP NLGKQKY GK Sbjct: 134 SLFDVPVFWPILLCYWIVLFVLTMKRQIMHMVKYKYIPFNLGKQKYSGK 182 >ref|XP_009757328.1| PREDICTED: protein RER1A-like [Nicotiana sylvestris] ref|XP_016475275.1| PREDICTED: protein RER1A-like [Nicotiana tabacum] Length = 194 Score = 101 bits (252), Expect = 8e-24 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 S+FDVPVFWPILLCYW+VLFVLTMKRQIMHM+KYKYIP NLGKQKY GK Sbjct: 134 SLFDVPVFWPILLCYWIVLFVLTMKRQIMHMIKYKYIPFNLGKQKYSGK 182 >ref|XP_009596537.1| PREDICTED: protein RER1A-like [Nicotiana tomentosiformis] ref|XP_016486214.1| PREDICTED: protein RER1A-like [Nicotiana tabacum] Length = 194 Score = 101 bits (252), Expect = 8e-24 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 S+FDVPVFWPILLCYW+VLFVLTMKRQIMHM+KYKYIP NLGKQKY GK Sbjct: 134 SLFDVPVFWPILLCYWIVLFVLTMKRQIMHMIKYKYIPFNLGKQKYSGK 182 >ref|XP_006645429.1| PREDICTED: protein RER1A-like, partial [Oryza brachyantha] Length = 162 Score = 100 bits (249), Expect = 1e-23 Identities = 42/49 (85%), Positives = 48/49 (97%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 S+FDVPVFWPILLCYW+VLFVLTMKRQI+HM+KYKY+P N+GKQKYGGK Sbjct: 104 SVFDVPVFWPILLCYWVVLFVLTMKRQIVHMIKYKYVPFNIGKQKYGGK 152 >dbj|BAJ87134.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 198 Score = 101 bits (251), Expect = 1e-23 Identities = 42/49 (85%), Positives = 48/49 (97%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 S+FDVPVFWPILLCYW+VLFVLTMKRQI+HM+KYKY+P N+GKQKYGGK Sbjct: 139 SVFDVPVFWPILLCYWIVLFVLTMKRQILHMVKYKYVPFNIGKQKYGGK 187 >ref|XP_003569310.1| PREDICTED: protein RER1B [Brachypodium distachyon] gb|KQK02287.1| hypothetical protein BRADI_2g00580v3 [Brachypodium distachyon] Length = 202 Score = 101 bits (251), Expect = 1e-23 Identities = 42/49 (85%), Positives = 48/49 (97%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 S+FDVPVFWPILLCYW+VLFVLTMKRQI+HM+KYKY+P N+GKQKYGGK Sbjct: 143 SVFDVPVFWPILLCYWIVLFVLTMKRQILHMVKYKYVPFNIGKQKYGGK 191 >emb|CDM81820.1| unnamed protein product [Triticum aestivum] Length = 203 Score = 101 bits (251), Expect = 1e-23 Identities = 42/49 (85%), Positives = 48/49 (97%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 S+FDVPVFWPILLCYW+VLFVLTMKRQI+HM+KYKY+P N+GKQKYGGK Sbjct: 144 SVFDVPVFWPILLCYWIVLFVLTMKRQILHMVKYKYVPFNIGKQKYGGK 192 >ref|XP_006298620.1| protein RER1B [Capsella rubella] ref|XP_023642024.1| protein RER1B [Capsella rubella] gb|EOA31518.1| hypothetical protein CARUB_v10014708mg [Capsella rubella] Length = 193 Score = 100 bits (250), Expect = 2e-23 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 S FD+PVFWPILLCYW+VLFVLTM+RQI HMMKYKYIP NLGKQKYGGK Sbjct: 134 SFFDIPVFWPILLCYWIVLFVLTMRRQIAHMMKYKYIPFNLGKQKYGGK 182 >gb|PON86000.1| Retrieval of early ER protein Rer [Trema orientalis] Length = 194 Score = 100 bits (250), Expect = 2e-23 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 SMFDVPVFWPILLCYW+VLFVLTM+RQI HM+KYKYIP N+GKQKYGGK Sbjct: 134 SMFDVPVFWPILLCYWIVLFVLTMRRQIAHMIKYKYIPFNIGKQKYGGK 182 >ref|XP_022873024.1| protein RER1B-like [Olea europaea var. sylvestris] ref|XP_022873025.1| protein RER1B-like [Olea europaea var. sylvestris] ref|XP_022873026.1| protein RER1B-like [Olea europaea var. sylvestris] Length = 195 Score = 100 bits (250), Expect = 2e-23 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = +3 Query: 3 SMFDVPVFWPILLCYWLVLFVLTMKRQIMHMMKYKYIPLNLGKQKYGGK 149 S+FDVPVFWPILLCYW+VLFVLTMKRQIMHM+KY+YIPLN+GKQKY GK Sbjct: 135 SVFDVPVFWPILLCYWIVLFVLTMKRQIMHMIKYRYIPLNIGKQKYSGK 183