BLASTX nr result
ID: Rehmannia32_contig00004359
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00004359 (448 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN00916.1| G2/Mitotic-specific cyclin A [Handroanthus impeti... 63 1e-08 ref|XP_011081889.1| cyclin-A2-1-like isoform X2 [Sesamum indicum] 60 2e-07 ref|XP_011081887.1| cyclin-A2-2-like isoform X1 [Sesamum indicum... 60 2e-07 ref|XP_011087041.1| cyclin-A2-2-like [Sesamum indicum] 57 1e-06 ref|XP_022881536.1| cyclin-A2-1-like [Olea europaea var. sylvest... 56 4e-06 >gb|PIN00916.1| G2/Mitotic-specific cyclin A [Handroanthus impetiginosus] Length = 491 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -2 Query: 447 TSGYMPNAIREKYKQSKFKCVSTLRSPKPVQSLF 346 T G M NAIREKYKQ+KFKCVSTLRSPKPVQSLF Sbjct: 458 TKGSMLNAIREKYKQTKFKCVSTLRSPKPVQSLF 491 >ref|XP_011081889.1| cyclin-A2-1-like isoform X2 [Sesamum indicum] Length = 491 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -2 Query: 447 TSGYMPNAIREKYKQSKFKCVSTLRSPKPVQSLF 346 TSG M NA+REKY+Q KFKCVSTL SPKPVQSLF Sbjct: 458 TSGCMLNAVREKYRQPKFKCVSTLSSPKPVQSLF 491 >ref|XP_011081887.1| cyclin-A2-2-like isoform X1 [Sesamum indicum] ref|XP_020550236.1| cyclin-A2-2-like isoform X1 [Sesamum indicum] Length = 495 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -2 Query: 447 TSGYMPNAIREKYKQSKFKCVSTLRSPKPVQSLF 346 TSG M NA+REKY+Q KFKCVSTL SPKPVQSLF Sbjct: 462 TSGCMLNAVREKYRQPKFKCVSTLSSPKPVQSLF 495 >ref|XP_011087041.1| cyclin-A2-2-like [Sesamum indicum] Length = 489 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/34 (85%), Positives = 29/34 (85%) Frame = -2 Query: 447 TSGYMPNAIREKYKQSKFKCVSTLRSPKPVQSLF 346 TSG M NAIREKYKQSKFKCVSTL KPVQSLF Sbjct: 456 TSGCMLNAIREKYKQSKFKCVSTLCPSKPVQSLF 489 >ref|XP_022881536.1| cyclin-A2-1-like [Olea europaea var. sylvestris] Length = 479 Score = 55.8 bits (133), Expect = 4e-06 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = -2 Query: 447 TSGYMPNAIREKYKQSKFKCVSTLRSPKPVQSLF 346 T G AIREKYKQSKFKCVSTL SPKPVQSLF Sbjct: 446 THGCKLPAIREKYKQSKFKCVSTLSSPKPVQSLF 479